Gene Information

Name : Cspa_c24920 (Cspa_c24920)
Accession : YP_007455511.1
Strain : Clostridium saccharoperbutylacetonicum N1-4(HMT)
Genome accession: NC_020291
Putative virulence/resistance : Resistance
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2745323 - 2745979 bp
Length : 657 bp
Strand : +
Note : -

DNA sequence :
TTGAAAATAAATATATTGATTGTAGAAGATGATGAGGCTATTTCTAATTTAATAAAAATAAATTTGAATATGGCTGGTTA
TGGAAGTAAGCAGATATTTGATGGAGTAGAAGCTTATAATTTATTAAAAGAGGAAGCTTTTGACTTAATACTTATGGATA
TTATGCTGCCAGGTATGGATGGCTTTGAATTAATGGAGAAAATAAGAGAATTAAATACACCAGTGATATTTTTGACAGCC
AAAAATGGACTGGCTGACAAGGTTACAGGTTTAAAATCAGGTGCAGAAGACTATATTGTAAAACCTTTTGAAACTGTTGA
GTTATTAGCGAGGATTGAAGTGGTTTTGAGGAGATATTCTAAAAATAATGATTGCATAGAATTTAAAAATTTGAAAATAT
ATGAAGATGAACGAATAGTAAAAAAAGCTGATGAGATAATTGAACTTACTCTTAAAGAATTTGAACTCATTCTAATGCTA
GTAAAAAATAAAAATATAGCCTTATCTCGGGAATATTTATTAGAAAAAGTATGGGGATATGAATACATGGGTGAAACAAG
GACAATAGATACCCATATTCAAAAACTTAGAAAGAAATTAGAGATAACAGAATATATAAAAACTGTATATAAAATTGGAT
ATAGATTAGAGGAGTAA

Protein sequence :
MKINILIVEDDEAISNLIKINLNMAGYGSKQIFDGVEAYNLLKEEAFDLILMDIMLPGMDGFELMEKIRELNTPVIFLTA
KNGLADKVTGLKSGAEDYIVKPFETVELLARIEVVLRRYSKNNDCIEFKNLKIYEDERIVKKADEIIELTLKEFELILML
VKNKNIALSREYLLEKVWGYEYMGETRTIDTHIQKLRKKLEITEYIKTVYKIGYRLEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 9e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-33 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-33 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-33 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 9e-34 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-33 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-33 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-33 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-33 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-33 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-33 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 5e-33 42
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1202. Protein 6e-34 41
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 4e-37 41
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 9e-30 41
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 9e-30 41
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 9e-30 41
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 9e-30 41
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 9e-30 41
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 9e-30 41
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 9e-30 41
Cspa_c24920 YP_007455511.1 Two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 9e-30 41