Gene Information

Name : Cspa_c08330 (Cspa_c08330)
Accession : YP_007453864.1
Strain : Clostridium saccharoperbutylacetonicum N1-4(HMT)
Genome accession: NC_020291
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 911769 - 912458 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
ATGAATCCATTAACAAAAGGCCAAATTACTATTCTTGTAGTAGATGATGAAAAAAGTATAATTGATTTTATTAAAATGGG
TTTAGAATCAGAAGGGTATATAGTATATTCTGCTTTTGATGGGAATGAGGCTATTAAATTAGCTGAAGAAATAAATCCAC
ATATAGTAATACTAGATATTATGCTGCCTGGAATGGATGGATATGAAGTGTGTTCAAGGCTTAAAAGATTGATTAAAACA
TCAGTTATTATGCTTACAGCTAGAGATGATGTTGATGATAGGGTTAAGGGACTAGATATTGGGGCAGATGATTATATGGC
AAAGCCTTTTAGTTTTAAAGAACTTTTAGCGCGTATTAATGCTAGAATTAGAAATAGCTATCCAGAATTATACGATATTG
TACATATAGGTGAATTTTCTATTGATGATGGTGCACATGAAATTACATATTGTGGGAATACATTAGAATTGCCCCCAACT
CAGTATAATTTATTAAGATTTTTACTAATAAATAATGGAATTGCATTAAGTAAAGCTCTCATACTAGAAAAAGTATGGGG
ATATGATTTCAATGGAGAGGAAAATATTGTTGAGGTATATATAAGATATCTCCGTGATAAGATTGAAGATAATGAGCACA
ATATTATCAAGACTGTTCGTGGTGTTGGGTATAAAATGGTGGCACAATGA

Protein sequence :
MNPLTKGQITILVVDDEKSIIDFIKMGLESEGYIVYSAFDGNEAIKLAEEINPHIVILDIMLPGMDGYEVCSRLKRLIKT
SVIMLTARDDVDDRVKGLDIGADDYMAKPFSFKELLARINARIRNSYPELYDIVHIGEFSIDDGAHEITYCGNTLELPPT
QYNLLRFLLINNGIALSKALILEKVWGYDFNGEENIVEVYIRYLRDKIEDNEHNIIKTVRGVGYKMVAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-41 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-39 44
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-39 44
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-39 44
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-39 44
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-39 44
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-39 44
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-39 44
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-39 44
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-39 44
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-39 44
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 7e-38 42
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 7e-38 42
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 7e-38 42
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 7e-38 42
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 7e-38 42
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 7e-38 42
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 7e-38 42
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 7e-38 42
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-35 42
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 9e-33 41
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family BAC0197 Protein 5e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family VFG0596 Protein 2e-41 41
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family VFG1390 Protein 5e-39 41
Cspa_c08330 YP_007453864.1 Two component transcriptional regulator, winged helix family VFG1386 Protein 2e-44 41