Gene Information

Name : A605_04345 (A605_04345)
Accession : YP_007464242.1
Strain : Corynebacterium halotolerans YIM 70093
Genome accession: NC_020302
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 927080 - 927775 bp
Length : 696 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAATTCTTGTGGTGGACGATGAGAAGGCGGTTCGCGAATCCCTGCGGAGATCACTCAGCTTCAACGGATACGACGT
CTCGCTGGCCGAGGACGGCGTTGAGGCGTTGGGAGTGATCAGCAGGGTGCAGCCCGATCTGACCGTCCTGGACGTGATGA
TGCCCCGGATGGACGGCCTCGAGGTCTGTCGCAATCTCCGCAGCACGGGCTATGATCGTCCGATTCTCATGCTCACCGCC
CGCGACGGCGTCTCCGACCGCGTCGCGGGTCTGGACGCCGGCGCCGACGACTACCTGCCCAAGCCCTTCGCCCTCGAGGA
ACTGCTCGCCCGCGTCCGCGCCCTGCTGCGCCGCGCCGCCGCCGACGCGATCGGTGGGGAGGGGGACAGCGATGAGCTCG
TCTTCGAGGATCTGCGCCTGAACCCCGACACCCGTGACGTCCGCCGCGGTGAACGTCCGATCAGTCTCACCCGCACCGAG
TTCTCTCTGCTGAAGCTGCTGATGGCCAACCCGCGGCGGGTGCTCTCCCGCACCACCATCCTCGAGGAGGTCTGGGGCTA
TGATTTCCCGACCTCGGGTAATGCGCTCGAGGTCTACATCGGCTACCTGCGCCGTAAGACCGAGGCCGAGGGGGAGGCCC
GTCTCATCCACACTGTCCGCGGCGTCGGTTACGTCCTCCGGGAGACCGCTCCGTGA

Protein sequence :
MKILVVDDEKAVRESLRRSLSFNGYDVSLAEDGVEALGVISRVQPDLTVLDVMMPRMDGLEVCRNLRSTGYDRPILMLTA
RDGVSDRVAGLDAGADDYLPKPFALEELLARVRALLRRAAADAIGGEGDSDELVFEDLRLNPDTRDVRRGERPISLTRTE
FSLLKLLMANPRRVLSRTTILEEVWGYDFPTSGNALEVYIGYLRRKTEAEGEARLIHTVRGVGYVLRETAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A605_04345 YP_007464242.1 two component system response regulator BAC0125 Protein 3e-32 47
A605_04345 YP_007464242.1 two component system response regulator BAC0083 Protein 7e-30 46
A605_04345 YP_007464242.1 two component system response regulator BAC0197 Protein 2e-28 44
A605_04345 YP_007464242.1 two component system response regulator HE999704.1.gene1528. Protein 5e-37 43
A605_04345 YP_007464242.1 two component system response regulator BAC0111 Protein 9e-32 43
A605_04345 YP_007464242.1 two component system response regulator BAC0308 Protein 8e-31 43
A605_04345 YP_007464242.1 two component system response regulator NC_002952.2859905.p0 Protein 1e-34 43
A605_04345 YP_007464242.1 two component system response regulator NC_002951.3237708.p0 Protein 1e-34 43
A605_04345 YP_007464242.1 two component system response regulator NC_003923.1003749.p0 Protein 1e-34 43
A605_04345 YP_007464242.1 two component system response regulator NC_002758.1121668.p0 Protein 1e-34 43
A605_04345 YP_007464242.1 two component system response regulator NC_009641.5332272.p0 Protein 1e-34 43
A605_04345 YP_007464242.1 two component system response regulator NC_013450.8614421.p0 Protein 1e-34 43
A605_04345 YP_007464242.1 two component system response regulator NC_007793.3914279.p0 Protein 1e-34 43
A605_04345 YP_007464242.1 two component system response regulator NC_007622.3794472.p0 Protein 1e-34 43
A605_04345 YP_007464242.1 two component system response regulator NC_002745.1124361.p0 Protein 1e-34 43
A605_04345 YP_007464242.1 two component system response regulator NC_009782.5559369.p0 Protein 1e-34 43
A605_04345 YP_007464242.1 two component system response regulator BAC0638 Protein 2e-22 42
A605_04345 YP_007464242.1 two component system response regulator CP004022.1.gene3215. Protein 3e-26 41
A605_04345 YP_007464242.1 two component system response regulator NC_012469.1.7686381. Protein 6e-34 41
A605_04345 YP_007464242.1 two component system response regulator CP000034.1.gene3671. Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A605_04345 YP_007464242.1 two component system response regulator VFG1390 Protein 4e-72 75
A605_04345 YP_007464242.1 two component system response regulator VFG1389 Protein 6e-38 50
A605_04345 YP_007464242.1 two component system response regulator VFG1386 Protein 1e-43 48
A605_04345 YP_007464242.1 two component system response regulator VFG0596 Protein 3e-31 43