Gene Information

Name : yycF (BAM5036_3661)
Accession : YP_007499313.1
Strain : Bacillus amyloliquefaciens UCMB5036
Genome accession: NC_020410
Putative virulence/resistance : Virulence
Product : two-component response regulator [YycF]
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3844044 - 3844754 bp
Length : 711 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 9384377, 9829949, 10878122, 15153768, 12950927,17581128; Product type r : regulator

DNA sequence :
ATGATGGATAAGAAAATCCTTGTAGTCGATGATGAAAAACCGATTGCAGATATATTAGAGTTTAATTTAAGAAAAGAAGG
CTATGACGTGCATTGTGCGTACGACGGAAACGAAGCCGTGGAAATGGTGGAGGAGCTTCAGCCTGATTTAATTCTTTTAG
ATATTATGCTTCCGAATAAAGACGGAGTTGAAGTGTGCCGGGAAGTCCGGAAAAAATATGATATGCCGATTATTATGCTG
ACGGCAAAAGACTCGGAGATTGACAAGGTCATCGGGCTTGAAATCGGAGCGGATGACTATGTCACGAAGCCTTTCAGCAC
GCGTGAGCTTCTGGCCCGCGTCAAAGCGAACCTGCGCCGCCAGCTTACGGTTGCGCCGGCTGAGGAAGAATCAGCTTCTA
ATGACATTCATATCGGTTCTCTCGTCATCTTCCCTGACGCTTATGTCGTATCAAAAAGAGAAGAAACGATCGAGCTGACT
CATCGTGAGTTTGAATTGCTTCATTACTTAGCCAAACATATCGGACAGGTTATGACGCGTGAGCATCTGCTGCAGACTGT
GTGGGGCTATGACTATTTCGGTGATGTGAGAACGGTGGATGTAACAGTGCGCCGTCTCCGTGAGAAAATCGAGGATAATC
CGAGCCATCCGAACTGGATCGTCACAAGACGGGGTGTCGGTTATTACTTGAGAAACCCTGAACAGGACTAA

Protein sequence :
MMDKKILVVDDEKPIADILEFNLRKEGYDVHCAYDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKKYDMPIIML
TAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRRQLTVAPAEEESASNDIHIGSLVIFPDAYVVSKREETIELT
HREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPEQD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-31 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_007499313.1 two-component response regulator [YycF] NC_012469.1.7685629. Protein 1e-65 68
yycF YP_007499313.1 two-component response regulator [YycF] NC_002758.1121668.p0 Protein 2e-53 56
yycF YP_007499313.1 two-component response regulator [YycF] NC_009641.5332272.p0 Protein 2e-53 56
yycF YP_007499313.1 two-component response regulator [YycF] NC_013450.8614421.p0 Protein 2e-53 56
yycF YP_007499313.1 two-component response regulator [YycF] NC_007793.3914279.p0 Protein 2e-53 56
yycF YP_007499313.1 two-component response regulator [YycF] NC_002952.2859905.p0 Protein 3e-53 56
yycF YP_007499313.1 two-component response regulator [YycF] NC_003923.1003749.p0 Protein 2e-53 56
yycF YP_007499313.1 two-component response regulator [YycF] NC_002745.1124361.p0 Protein 2e-53 56
yycF YP_007499313.1 two-component response regulator [YycF] NC_009782.5559369.p0 Protein 2e-53 56
yycF YP_007499313.1 two-component response regulator [YycF] NC_002951.3237708.p0 Protein 2e-53 56
yycF YP_007499313.1 two-component response regulator [YycF] NC_007622.3794472.p0 Protein 2e-53 56
yycF YP_007499313.1 two-component response regulator [YycF] HE999704.1.gene2815. Protein 4e-47 52
yycF YP_007499313.1 two-component response regulator [YycF] AE016830.1.gene1681. Protein 4e-45 49
yycF YP_007499313.1 two-component response regulator [YycF] NC_012469.1.7686381. Protein 3e-43 49
yycF YP_007499313.1 two-component response regulator [YycF] FJ349556.1.orf0.gene Protein 6e-40 47
yycF YP_007499313.1 two-component response regulator [YycF] HE999704.1.gene1528. Protein 5e-32 45
yycF YP_007499313.1 two-component response regulator [YycF] AF155139.2.orf0.gene Protein 9e-37 45
yycF YP_007499313.1 two-component response regulator [YycF] AM180355.1.gene1830. Protein 8e-39 45
yycF YP_007499313.1 two-component response regulator [YycF] AE000516.2.gene3505. Protein 5e-37 45
yycF YP_007499313.1 two-component response regulator [YycF] NC_014475.1.orf0.gen Protein 8e-38 43
yycF YP_007499313.1 two-component response regulator [YycF] NC_005054.2598277.p0 Protein 8e-38 43
yycF YP_007499313.1 two-component response regulator [YycF] NC_002951.3238224.p0 Protein 3e-34 43
yycF YP_007499313.1 two-component response regulator [YycF] NC_007793.3914065.p0 Protein 3e-34 43
yycF YP_007499313.1 two-component response regulator [YycF] NC_002758.1121390.p0 Protein 3e-34 43
yycF YP_007499313.1 two-component response regulator [YycF] NC_010079.5776364.p0 Protein 3e-34 43
yycF YP_007499313.1 two-component response regulator [YycF] NC_002952.2859858.p0 Protein 3e-34 43
yycF YP_007499313.1 two-component response regulator [YycF] NC_007622.3794948.p0 Protein 3e-34 43
yycF YP_007499313.1 two-component response regulator [YycF] NC_003923.1003417.p0 Protein 3e-34 43
yycF YP_007499313.1 two-component response regulator [YycF] NC_013450.8614146.p0 Protein 3e-34 43
yycF YP_007499313.1 two-component response regulator [YycF] AF130997.1.orf0.gene Protein 2e-36 42
yycF YP_007499313.1 two-component response regulator [YycF] DQ212986.1.gene4.p01 Protein 8e-37 42
yycF YP_007499313.1 two-component response regulator [YycF] AE015929.1.gene1106. Protein 2e-29 42
yycF YP_007499313.1 two-component response regulator [YycF] CP001138.1.gene2239. Protein 2e-27 42
yycF YP_007499313.1 two-component response regulator [YycF] CP001918.1.gene3444. Protein 3e-28 42
yycF YP_007499313.1 two-component response regulator [YycF] BAC0039 Protein 6e-29 42
yycF YP_007499313.1 two-component response regulator [YycF] BAC0596 Protein 2e-27 42
yycF YP_007499313.1 two-component response regulator [YycF] CP000034.1.gene2186. Protein 6e-29 42
yycF YP_007499313.1 two-component response regulator [YycF] NC_002695.1.916589.p Protein 5e-29 42
yycF YP_007499313.1 two-component response regulator [YycF] AF162694.1.orf4.gene Protein 6e-33 41
yycF YP_007499313.1 two-component response regulator [YycF] CP001918.1.gene5135. Protein 7e-27 41
yycF YP_007499313.1 two-component response regulator [YycF] CP004022.1.gene3215. Protein 1e-34 41
yycF YP_007499313.1 two-component response regulator [YycF] CP004022.1.gene1676. Protein 6e-28 41
yycF YP_007499313.1 two-component response regulator [YycF] CP000647.1.gene2531. Protein 4e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_007499313.1 two-component response regulator [YycF] VFG1563 Protein 1e-31 43
yycF YP_007499313.1 two-component response regulator [YycF] VFG1389 Protein 1e-28 43
yycF YP_007499313.1 two-component response regulator [YycF] VFG1390 Protein 5e-35 42
yycF YP_007499313.1 two-component response regulator [YycF] VFG1702 Protein 1e-31 41