Gene Information

Name : MU9_128 (MU9_128)
Accession : YP_007503547.1
Strain : Morganella morganii KT
Genome accession: NC_020418
Putative virulence/resistance : Virulence
Product : putative regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 137273 - 137482 bp
Length : 210 bp
Strand : +
Note : -

DNA sequence :
ATGAGCACTCAAGCGATTCCCTTATTAGATGACCAATGCGTTGATATGAAATTTATAACCCGTTTAACTGGATTAACTGA
TAAATGGTTTTATAAATTGATACAAGATGGAGAGTTTCCAAAACCGATAAAACTGGGGCGTAGCTCTCGCTGGTTAAAGA
GCGAAGTCGAGAATTGGCTACAGGCACGTATTACCGAATCCAGAGCTTAA

Protein sequence :
MSTQAIPLLDDQCVDMKFITRLTGLTDKWFYKLIQDGEFPKPIKLGRSSRWLKSEVENWLQARITESRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 1e-21 78
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 4e-21 77
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 7e-21 77
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 5e-21 77
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 5e-21 77
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 5e-21 73
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 5e-21 73
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 1e-14 72
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 1e-14 72
unnamed AAL08466.1 unknown Not tested SRL Protein 7e-21 72
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 4e-18 65
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-18 65

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MU9_128 YP_007503547.1 putative regulatory protein VFG0651 Protein 1e-21 77
MU9_128 YP_007503547.1 putative regulatory protein VFG1057 Protein 3e-21 72
MU9_128 YP_007503547.1 putative regulatory protein VFG1480 Protein 1e-18 65