Gene Information

Name : S58_49300 (S58_49300)
Accession : YP_007514496.1
Strain : Bradyrhizobium oligotrophicum S58
Genome accession: NC_020453
Putative virulence/resistance : Resistance
Product : dihydropteroate synthase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5574212 - 5575069 bp
Length : 858 bp
Strand : +
Note : -

DNA sequence :
ATGAGCGCCCTTTCGCCGCACGCCGCCTCGGACCTCGCGTCGAGCCACCCGCTGCTGCGGCCGTGGCTGGCGCGTCCCTA
CCCCGCGGTGATGGGCATCCTCAACGTCACGCCGGATTCGTTCTCCGATGGCGGCCGTTTCAATGCGCCGGACCGCGCCA
TCGAACAGGCGAGGGGCATGATCGCAGCCGGCGCCGACATCATCGACATCGGCGCCGAATCGACCCGGCCCTACACGGGC
GCGGAGCCGGTGACGGCCGAGGAGGAGCTCGCGCGCCTGAAGCCCGTCCTGCCCGCGATCGTCGCACTCGGTGTGCCCGT
GTCGATCGACAGCATGAAATCCCGAGTTGCCGACTTCGCGCTGGAACAGGGCGCGGCGATCGCAAACGACGTCTGGGGCC
TGCAGCGCGACCCCGCGATGGCCGAAATCGTCGCCGCGCATGGCGCGCCGATCGTCGTCATGCACAACCGTGCGGATGTG
GATCCTGGGATCGACATCATCGCCGACATGCTCGGCTTCTTCGCGCGCTCGCTCGACATCGCCGCCAAGGCCGGCATTCC
CGCTGGGAATATCGTGCTCGATCCCGGCATCGGCTTCGGCAAGACGGCGGAGCAGAGCATGATCGCGCTGGCGCGCCTGG
GTGAGTTTGCGCGCTTCGGGCTGCCGCTGCTGGTCGGCGCCTCGCGCAAGCGCTTCATCAATTCGGTGGTGACGTCGGAA
CCGCAGCAACGGCTCGGCGGATCGATCGCGGCGCATCTCATCGCGGCTCAGCGCGGCGCTGCGATCATCCGGGCGCACGA
CGTCGCCGAGACGGTTCAGGCCGTGCGCGTGGCAGCAAGCATCGAGGCACTGGGATGA

Protein sequence :
MSALSPHAASDLASSHPLLRPWLARPYPAVMGILNVTPDSFSDGGRFNAPDRAIEQARGMIAAGADIIDIGAESTRPYTG
AEPVTAEEELARLKPVLPAIVALGVPVSIDSMKSRVADFALEQGAAIANDVWGLQRDPAMAEIVAAHGAPIVVMHNRADV
DPGIDIIADMLGFFARSLDIAAKAGIPAGNIVLDPGIGFGKTAEQSMIALARLGEFARFGLPLLVGASRKRFINSVVTSE
PQQRLGGSIAAHLIAAQRGAAIIRAHDVAETVQAVRVAASIEALG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sul2 AEZ06044.1 Sul2, sulphonamide-insensitive dihydropteroate synthase Not tested Tn6167 Protein 2e-26 43
sul2 AEA34678.1 dihydropteroate synthase Not tested Not named Protein 1e-26 43
sulI2 AFV47959.1 sulphonamide-insensitive dihydropteroate synthase SulI2 Not tested AbaR25 Protein 1e-26 43
ABK1_0255 YP_005512827.1 Dihydropteroate synthase type-2 Not tested AbaR4d Protein 2e-26 43
BJAB07104_00246 YP_008207711.1 Dihydropteroate synthase-related enzyme Not tested AbaR25 Protein 2e-26 43
BJAB0868_00253 YP_008211579.1 Dihydropteroate synthase-related enzyme Not tested AbaR26 Protein 2e-26 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S58_49300 YP_007514496.1 dihydropteroate synthase CP000647.1.gene3624. Protein 7e-32 47
S58_49300 YP_007514496.1 dihydropteroate synthase CP001138.1.gene3456. Protein 3e-32 47
S58_49300 YP_007514496.1 dihydropteroate synthase AM180355.1.gene1650. Protein 5e-42 46
S58_49300 YP_007514496.1 dihydropteroate synthase NC_002695.1.916103.p Protein 4e-31 45
S58_49300 YP_007514496.1 dihydropteroate synthase CP000034.1.gene3358. Protein 4e-31 45
S58_49300 YP_007514496.1 dihydropteroate synthase NC_002758.1120474.p0 Protein 2e-29 45
S58_49300 YP_007514496.1 dihydropteroate synthase NC_009782.5559617.p0 Protein 2e-29 45
S58_49300 YP_007514496.1 dihydropteroate synthase NC_002745.1123263.p0 Protein 2e-29 45
S58_49300 YP_007514496.1 dihydropteroate synthase NC_013450.8613224.p0 Protein 2e-29 45
S58_49300 YP_007514496.1 dihydropteroate synthase CP004022.1.gene3451. Protein 4e-31 44
S58_49300 YP_007514496.1 dihydropteroate synthase CP002695.1.gene1085. Protein 1e-27 44
S58_49300 YP_007514496.1 dihydropteroate synthase NC_010410.6003232.p0 Protein 2e-20 44
S58_49300 YP_007514496.1 dihydropteroate synthase NC_011595.7059722.p0 Protein 2e-20 44
S58_49300 YP_007514496.1 dihydropteroate synthase NC_010400.5986775.p0 Protein 2e-19 44
S58_49300 YP_007514496.1 dihydropteroate synthase NC_011586.7045137.p0 Protein 2e-20 44
S58_49300 YP_007514496.1 dihydropteroate synthase NC_007793.3915320.p0 Protein 4e-29 44
S58_49300 YP_007514496.1 dihydropteroate synthase NC_009641.5330254.p0 Protein 3e-28 44
S58_49300 YP_007514496.1 dihydropteroate synthase NC_002952.2860679.p0 Protein 1e-29 44
S58_49300 YP_007514496.1 dihydropteroate synthase NC_003923.1002573.p0 Protein 4e-29 44
S58_49300 YP_007514496.1 dihydropteroate synthase NC_002951.3237126.p0 Protein 1e-28 44
S58_49300 YP_007514496.1 dihydropteroate synthase CP000675.2.gene3019. Protein 3e-33 43
S58_49300 YP_007514496.1 dihydropteroate synthase DQ464881.1.gene2.p01 Protein 3e-26 43
S58_49300 YP_007514496.1 dihydropteroate synthase NC_007622.3794340.p0 Protein 4e-29 43
S58_49300 YP_007514496.1 dihydropteroate synthase AE000516.2.gene3902. Protein 3e-23 43
S58_49300 YP_007514496.1 dihydropteroate synthase NC_002516.2.881715.p Protein 3e-31 42
S58_49300 YP_007514496.1 dihydropteroate synthase NC_012469.1.7686560. Protein 2e-17 41