Gene Information

Name : S58_58600 (S58_58600)
Accession : YP_007515424.1
Strain : Bradyrhizobium oligotrophicum S58
Genome accession: NC_020453
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6639171 - 6639878 bp
Length : 708 bp
Strand : -
Note : -

DNA sequence :
ATGGGCGCGCGAATTCTGGTGGTGGAGGACGAGGAGGCGCTGACCACGCTGCTGCGCTACAACCTCGAAGCCGAGGGCTA
TGAGGTCGAGACCGTGGCGCGCGGCGACGAGGCCGACACGCGGCTGAAGGAGCGCGTTCCCGATCTCGTCGTGCTCGACT
GGATGCTGCCGGGCCTGTCCGGCATCGAACTGTGCCGCCGCCTGCGCGCGCGGTCCGAGACCAGGCAGCTGCCGATCATC
ATGCTGACCGCGCGCGGCGAGGAGAGCGAGCGCGTGCGCGGGCTGGCCACCGGCGCCGACGACTACATCGTCAAGCCGTT
CTCGGTGCCGGAGCTGTTGGCGCGCGTGAAGGGCCTGCTGCGCCGGGCGAGCCCGGAGCGGCTGGCGACCGTGCTGTCCT
ATGGTGATATCGAGCTCGACCGCGAGAAGCGCCGCGTCGCGCGCTCGGGCCGGCCGATCGATCTCGGCCCGACCGAATAC
CGCCTGCTCGAATTCTTCCTGGAGCATCCCGGGCGGGTGTTCAGCCGCGAGCAGCTGCTCGACAGCGTCTGGGGCCGCGA
CATCTACATCGACGAGCGCACCGTCGACGTTCACATCGGCCGTTTGCGCAAGCTGCTCAATCCGGGCCGCGAGCAGGACC
CGATCCGCACCGTGCGCGGCGCCGGCTATGCGCTCGACGACCGGTTCGCCAAATCCGAGCAGGCGTGA

Protein sequence :
MGARILVVEDEEALTTLLRYNLEAEGYEVETVARGDEADTRLKERVPDLVVLDWMLPGLSGIELCRRLRARSETRQLPII
MLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLLRRASPERLATVLSYGDIELDREKRRVARSGRPIDLGPTEY
RLLEFFLEHPGRVFSREQLLDSVWGRDIYIDERTVDVHIGRLRKLLNPGREQDPIRTVRGAGYALDDRFAKSEQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-35 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake AE000516.2.gene3505. Protein 2e-35 45
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_010400.5986590.p0 Protein 4e-37 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_011595.7057856.p0 Protein 7e-38 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_010410.6002989.p0 Protein 7e-38 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_002952.2859905.p0 Protein 5e-42 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_009641.5332272.p0 Protein 8e-42 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_013450.8614421.p0 Protein 8e-42 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_007793.3914279.p0 Protein 8e-42 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_003923.1003749.p0 Protein 9e-42 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_007622.3794472.p0 Protein 5e-42 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_002745.1124361.p0 Protein 8e-42 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_009782.5559369.p0 Protein 8e-42 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_002951.3237708.p0 Protein 8e-42 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_002758.1121668.p0 Protein 8e-42 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake CP001138.1.gene2239. Protein 1e-34 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake CP000034.1.gene2186. Protein 1e-34 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake CP001918.1.gene3444. Protein 1e-34 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_002695.1.916589.p Protein 7e-35 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake BAC0596 Protein 1e-34 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake BAC0039 Protein 1e-34 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake CP000647.1.gene2531. Protein 8e-35 42
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake HE999704.1.gene1528. Protein 1e-30 41
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake HE999704.1.gene2815. Protein 4e-38 41
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake NC_008702.1.4607594. Protein 1e-36 41
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake CP004022.1.gene1676. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake VFG1390 Protein 5e-39 45
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake VFG1702 Protein 8e-36 44
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake VFG1563 Protein 4e-35 43
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake VFG1389 Protein 4e-30 42
S58_58600 YP_007515424.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake VFG1386 Protein 5e-35 41