Gene Information

Name : resD (BN159_2306)
Accession : YP_007520812.1
Strain : Streptomyces davawensis JCM 4913
Genome accession: NC_020504
Putative virulence/resistance : Virulence
Product : Transcriptional regulatory protein resD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2589086 - 2589772 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGGAACAGCAGCAGCCCCGGATCCTCGTCGTCGACGACGACCCGACGGTCGCGGAGGTGGTCTCCGGGTACCTCGACCG
CGCCGGATACGTCGTGGACCGCGCCGGTGACGGGCCCGACGCCCTCGCACGGGCCGCCGAGCACTGGCCGGACCTGGTCG
TCCTGGATCTGATGCTGCCCGGCATGGACGGCCTGGAGGTGTGCCGCCGGATGCGCGGACAGGGCCCCGTGCCGGTCATC
ATGCTCACCGCGCGCGGCGACGAGGACGACCGCATCCTCGGCCTGGAGGTCGGCGCCGACGACTACGTCACCAAGCCCTT
CAGCCCCCGCGAACTCGTCCTGCGCGTCGAGTCCGTGCTGCGCCGCGTCCGCCCCGCCCAGGCGCCGGGACCGCTGCGCG
CCGCGGGTCTCACCGTCGACCCGGCGGCCCGCCGGGCCGTCAAGGACGGCGCCGAACTCGCCCTCACCGTCCGCGAGTTC
GACCTGCTCACCTTCTTCCTGCGGCACCCGGGCCGGGTGTTCGGCCGGGAGGACCTGATGCGGGAGGTGTGGGGCTGGGA
CTTCGGCGATCTGTCGACCGTCACCGTCCATGTGCGCCGGCTGCGCGGCAAGGTCGAGGACGATCCGGCCCGCCCCCGGC
TGATCCAGACGGTGTGGGGCGTCGGCTACCGGTTCGAGGGGGTCTGA

Protein sequence :
MEQQQPRILVVDDDPTVAEVVSGYLDRAGYVVDRAGDGPDALARAAEHWPDLVVLDLMLPGMDGLEVCRRMRGQGPVPVI
MLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVLRRVRPAQAPGPLRAAGLTVDPAARRAVKDGAELALTVREF
DLLTFFLRHPGRVFGREDLMREVWGWDFGDLSTVTVHVRRLRGKVEDDPARPRLIQTVWGVGYRFEGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-28 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-37 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-36 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_007520812.1 Transcriptional regulatory protein resD AE000516.2.gene3505. Protein 5e-44 48
resD YP_007520812.1 Transcriptional regulatory protein resD NC_012469.1.7685629. Protein 2e-40 47
resD YP_007520812.1 Transcriptional regulatory protein resD BAC0347 Protein 4e-32 43
resD YP_007520812.1 Transcriptional regulatory protein resD NC_011595.7057856.p0 Protein 4e-35 43
resD YP_007520812.1 Transcriptional regulatory protein resD BAC0083 Protein 2e-33 43
resD YP_007520812.1 Transcriptional regulatory protein resD NC_010410.6002989.p0 Protein 4e-35 43
resD YP_007520812.1 Transcriptional regulatory protein resD NC_010400.5986590.p0 Protein 2e-35 43
resD YP_007520812.1 Transcriptional regulatory protein resD NC_002952.2859905.p0 Protein 2e-40 42
resD YP_007520812.1 Transcriptional regulatory protein resD NC_002745.1124361.p0 Protein 3e-40 42
resD YP_007520812.1 Transcriptional regulatory protein resD NC_009782.5559369.p0 Protein 3e-40 42
resD YP_007520812.1 Transcriptional regulatory protein resD NC_002951.3237708.p0 Protein 3e-40 42
resD YP_007520812.1 Transcriptional regulatory protein resD NC_003923.1003749.p0 Protein 3e-40 42
resD YP_007520812.1 Transcriptional regulatory protein resD NC_002758.1121668.p0 Protein 3e-40 42
resD YP_007520812.1 Transcriptional regulatory protein resD NC_007622.3794472.p0 Protein 2e-40 42
resD YP_007520812.1 Transcriptional regulatory protein resD NC_009641.5332272.p0 Protein 3e-40 42
resD YP_007520812.1 Transcriptional regulatory protein resD NC_013450.8614421.p0 Protein 3e-40 42
resD YP_007520812.1 Transcriptional regulatory protein resD NC_007793.3914279.p0 Protein 3e-40 42
resD YP_007520812.1 Transcriptional regulatory protein resD BAC0125 Protein 1e-32 42
resD YP_007520812.1 Transcriptional regulatory protein resD BAC0638 Protein 3e-26 42
resD YP_007520812.1 Transcriptional regulatory protein resD CP000647.1.gene2531. Protein 2e-33 42
resD YP_007520812.1 Transcriptional regulatory protein resD CP001918.1.gene3444. Protein 3e-33 42
resD YP_007520812.1 Transcriptional regulatory protein resD HE999704.1.gene1528. Protein 2e-29 41
resD YP_007520812.1 Transcriptional regulatory protein resD BAC0111 Protein 3e-34 41
resD YP_007520812.1 Transcriptional regulatory protein resD CP001138.1.gene2239. Protein 3e-32 41
resD YP_007520812.1 Transcriptional regulatory protein resD BAC0039 Protein 8e-33 41
resD YP_007520812.1 Transcriptional regulatory protein resD BAC0596 Protein 3e-32 41
resD YP_007520812.1 Transcriptional regulatory protein resD CP000034.1.gene2186. Protein 8e-33 41
resD YP_007520812.1 Transcriptional regulatory protein resD NC_002695.1.916589.p Protein 7e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_007520812.1 Transcriptional regulatory protein resD VFG1390 Protein 3e-34 46
resD YP_007520812.1 Transcriptional regulatory protein resD VFG0596 Protein 2e-28 44
resD YP_007520812.1 Transcriptional regulatory protein resD VFG1563 Protein 3e-37 43
resD YP_007520812.1 Transcriptional regulatory protein resD VFG1702 Protein 2e-36 42