Gene Information

Name : terE (BN159_4870)
Accession : YP_007523376.1
Strain : Streptomyces davawensis JCM 4913
Genome accession: NC_020504
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein TerE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5414360 - 5414935 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGCTGTAAGCCTGTCCAAGGGTGGCAACGTCTCGCTCACCAAGGAGGCTCCGGGCCTGACCGCCGTCACCGTGGGCCT
CGGCTGGGACGTCCGCACCACCACCGGCACGGACTTCGACCTCGACGCCTCCGCGATCGCGGTCAACACGCAGGGCAAGG
TCTACTCCGACGCCCACTTCGTGTTCTTCAACAACAAGCAGACCCCGGACCAGACCATCGTCCACACCGGCGACAACCGC
ACGGGCGAGGGCGCGGGCGACGACGAGGCGATCAACGTCAACCTGGCGGGCCTCCCCGCCGACATCGAGAAGATCGTCTT
CCCGGTCTCGATCTACGAGGCCGAGGGCCGCTCGCAGAACTTCGGCCAGGTCCGCAACGCCTACATCCGCATCCTCAACC
AGGCCGGCGGCGCCGAGATCGCCCGCTACGACCTCTCCGAGGACGCGGCCACCGAGACGGCCATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCCGTCGGCCAGGGCTACGCCTCGGGCCTGGTGGGCATCGCGCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNTQGKVYSDAHFVFFNNKQTPDQTIVHTGDNR
TGEGAGDDEAINVNLAGLPADIEKIVFPVSIYEAEGRSQNFGQVRNAYIRILNQAGGAEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLVGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-60 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-58 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 63
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-57 58
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-58 58
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-58 58
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terE YP_007523376.1 Tellurium resistance protein TerE BAC0390 Protein 2e-58 62
terE YP_007523376.1 Tellurium resistance protein TerE BAC0389 Protein 3e-57 58