Gene Information

Name : mtrA (BN159_5280)
Accession : YP_007523786.1
Strain : Streptomyces davawensis JCM 4913
Genome accession: NC_020504
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator mtrA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5885706 - 5886395 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
ATGATGTCGTTTATGAAGGGACGAGTCCTTGTCGTCGACGACGACACCGCACTGGCCGAGATGCTCGGCATCGTGCTGCG
TGGTGAAGGTTTCGAGCCGTCTTTCGTAGCCGACGGCGACAAGGCGCTGGCCGCTTTCCGTGAGACCAAGCCTGATCTGG
TGCTGCTCGACCTGATGCTGCCCGGACGGGACGGCATCGAGGTGTGCCGTCTGATCCGGGCGGAGTCGGGTGTGCCGATC
GTGATGCTCACGGCCAAGAGCGACACCGTCGATGTCGTCGTGGGCCTGGAGTCGGGCGCGGACGACTACATCGTCAAGCC
GTTCAAGCCGAAGGAGCTGGTCGCCCGGATCCGGGCGCGGCTGCGGAGGTCGGAGGAGCCGGCGCCGGAGCAGCTCGCCA
TCGGTGACCTGGTCATCGACGTGGCCGGGCACTCGGTGAAGCGGGACGGGCAGTCGATCGCGCTGACGCCGCTGGAGTTC
GACCTGCTGGTGGCGCTCGCGCGCAAGCCGTGGCAGGTGTTCACCCGCGAGGTCCTGCTGGAGCAGGTGTGGGGCTATCG
GCACGCCGCCGACACCCGCCTGGTCAATGTCCATGTACAGCGGCTGCGCTCCAAGGTCGAGAAGGACCCGGAGCGGCCGG
AGATCGTGGTGACCGTCCGTGGTGTCGGTTACAAGGCGGGACCGAGCTGA

Protein sequence :
MMSFMKGRVLVVDDDTALAEMLGIVLRGEGFEPSFVADGDKALAAFRETKPDLVLLDLMLPGRDGIEVCRLIRAESGVPI
VMLTAKSDTVDVVVGLESGADDYIVKPFKPKELVARIRARLRRSEEPAPEQLAIGDLVIDVAGHSVKRDGQSIALTPLEF
DLLVALARKPWQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKVEKDPERPEIVVTVRGVGYKAGPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_007523786.1 DNA-binding response regulator mtrA AE000516.2.gene3505. Protein 3e-80 75
mtrA YP_007523786.1 DNA-binding response regulator mtrA BAC0125 Protein 5e-34 46
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_012469.1.7685629. Protein 5e-45 46
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_012469.1.7686381. Protein 4e-42 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_002952.2859905.p0 Protein 1e-45 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_002758.1121668.p0 Protein 1e-45 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_007622.3794472.p0 Protein 8e-46 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_009641.5332272.p0 Protein 1e-45 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_013450.8614421.p0 Protein 1e-45 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_007793.3914279.p0 Protein 1e-45 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_002745.1124361.p0 Protein 1e-45 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_009782.5559369.p0 Protein 1e-45 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_002951.3237708.p0 Protein 1e-45 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_003923.1003749.p0 Protein 1e-45 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA HE999704.1.gene2815. Protein 7e-42 45
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_003923.1003417.p0 Protein 4e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_013450.8614146.p0 Protein 4e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_002951.3238224.p0 Protein 4e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_007793.3914065.p0 Protein 4e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_002758.1121390.p0 Protein 4e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_010079.5776364.p0 Protein 4e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_002952.2859858.p0 Protein 4e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_007622.3794948.p0 Protein 4e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA AE015929.1.gene1106. Protein 5e-36 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA CP000034.1.gene2186. Protein 1e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA NC_002695.1.916589.p Protein 1e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA BAC0596 Protein 2e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA BAC0039 Protein 1e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA CP001918.1.gene3444. Protein 1e-39 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA CP001138.1.gene2239. Protein 2e-40 43
mtrA YP_007523786.1 DNA-binding response regulator mtrA HE999704.1.gene1528. Protein 2e-34 42
mtrA YP_007523786.1 DNA-binding response regulator mtrA AE016830.1.gene1681. Protein 5e-41 42
mtrA YP_007523786.1 DNA-binding response regulator mtrA CP000647.1.gene2531. Protein 5e-39 42
mtrA YP_007523786.1 DNA-binding response regulator mtrA AF155139.2.orf0.gene Protein 4e-35 41
mtrA YP_007523786.1 DNA-binding response regulator mtrA FJ349556.1.orf0.gene Protein 2e-36 41
mtrA YP_007523786.1 DNA-binding response regulator mtrA BAC0197 Protein 7e-32 41
mtrA YP_007523786.1 DNA-binding response regulator mtrA CP000034.1.gene3671. Protein 6e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_007523786.1 DNA-binding response regulator mtrA VFG1390 Protein 2e-35 44
mtrA YP_007523786.1 DNA-binding response regulator mtrA VFG1389 Protein 6e-32 44
mtrA YP_007523786.1 DNA-binding response regulator mtrA VFG1702 Protein 8e-38 41