Gene Information

Name : H924_03080 (H924_03080)
Accession : YP_007529969.1
Strain : Corynebacterium callunae DSM 20147
Genome accession: NC_020506
Putative virulence/resistance : Virulence
Product : ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 653695 - 654504 bp
Length : 810 bp
Strand : -
Note : COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components

DNA sequence :
GTGACCACTACTTCGCACCAATTAAGCACCCACAATGTCTCGCTTTCCTATGGCGAGCGCAGTGTTATCAATGGCCTCAC
CCTCGACATCCCGCCGGGAAAAATCACCTCCATCGTCGGCCCCAACGGCTGCGGCAAATCCACTCTGTTGCGCGCCCTGG
CGCGCCTCCTTAAACCCACCTCCGGTGAGGTGCTTATCGACGACGCCCCGCTGGCAACGTTTCATGGCAAGGAACTAGCC
CGCATGTTGGGACTGTTACCCCAATCTCCTACCGCGCCCGACGGCATTGTGGTCGCTGACCTGGTGGGACGCGGACGCCA
CCCACACCAAGGCCTCATGGGCCGCTGGTCTACCCGGGATTATGAGGTGGTGGCCAAAGCTTTGGAAACCACCAATACCA
CCGACTTAGCAGAGCGCAGTATTGATGAGCTTTCTGGTGGCCAGCGCCAAAGAGTGTGGATTGCCATGGCGCTTGCTCAG
GAGACAGATATTTTATTACTTGATGAGCCCACTACCTATCTTGATATCGCCAATCAGCTAGAAGTCTTAGACCTACTTAC
TGATCTCAACCGCAGCCAAGGCACCACCATTGTTATGGTGCTCCATGAACTTGGCCTGGCAGCTCGTTATTCTGACCACC
TCATTGCAATGCACCAAGGACAGATTTATGCAGCCGGCACGTCTGCTGAAGTAGTCACAGAAACAATGATGCAGGAAGTT
TTTCATACCAAGGCTCGCGTTATTACCGATCCCATCTCCGGCGCACCTTTGGTGATGCCCATAGGCCGCCACCACGTCAC
CACCAATTAA

Protein sequence :
MTTTSHQLSTHNVSLSYGERSVINGLTLDIPPGKITSIVGPNGCGKSTLLRALARLLKPTSGEVLIDDAPLATFHGKELA
RMLGLLPQSPTAPDGIVVADLVGRGRHPHQGLMGRWSTRDYEVVAKALETTNTTDLAERSIDELSGGQRQRVWIAMALAQ
ETDILLLDEPTTYLDIANQLEVLDLLTDLNRSQGTTIVMVLHELGLAARYSDHLIAMHQGQIYAAGTSAEVVTETMMQEV
FHTKARVITDPISGAPLVMPIGRHHVTTN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
iusE YP_005143742.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 1e-71 54
SP_1035 NP_345510.1 iron-compound ABC transporter ATP-binding protein Not tested PPI-1 Protein 3e-68 48
SPN23F_09560 YP_002510939.1 ferric siderophore ABC transporter ATP-binding protein Virulence PPI-1 Protein 3e-68 48
fecE AAL08451.1 ATP-binding protein FecE Virulence SRL Protein 1e-56 48
fagC YP_005680307.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 1e-58 46
fagC YP_003782430.1 ABC transporter ATP-binding protein Not tested PiCp 1 Protein 1e-58 46
fagC YP_005682397.1 ATP binding cytoplasmic membrane protein Virulence PiCp 1 Protein 1e-58 46
fagC YP_005684488.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 1e-58 46
DIP0585 NP_938961.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 4e-52 43
ciuD YP_003783391.1 iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 5e-52 42
ciuD YP_005685432.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 5e-52 42
ciuD YP_005681255.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 5e-52 42
ciuD YP_005683346.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 5e-52 42
phuC YP_005686351.1 Iron(III) dicitrate transport permease-like protein yusV Virulence PiCp 7 Protein 2e-35 42
phuC YP_005682167.1 Iron(III) dicitrate transport permease-like protein yusV Virulence PiCp 7 Protein 1e-35 42
phuC YP_005684259.1 Iron(III) dicitrate transport permease-like protein yusV Virulence PiCp 7 Protein 1e-35 42
cpfrc_01918 YP_003784318.1 hypothetical protein Not tested PiCp 7 Protein 2e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H924_03080 YP_007529969.1 ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component BAC0164 Protein 9e-57 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H924_03080 YP_007529969.1 ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component VFG0925 Protein 1e-70 50
H924_03080 YP_007529969.1 ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component VFG1042 Protein 8e-57 48