Gene Information

Name : ykoG (BSU6051_13250)
Accession : YP_007533272.1
Strain : Bacillus subtilis 6051-HGW
Genome accession: NC_020507
Putative virulence/resistance : Virulence
Product : two-component response regulator YkoH
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1391951 - 1392637 bp
Length : 687 bp
Strand : +
Note : Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11717295; Product type r: regulator

DNA sequence :
TTGGAAAAAGGACACATATTAATTGTGGAAGATGAAGAAAAAATCGCCAGGGTTCTTCAGCTTGAATTGGAATATGAAGG
ATACAGCGTCACGATCAAACACAATGGCACAGAAGGTCTTGATGCGGCAGCGGAAGGCGGGTATTCCTTGGTGCTTCTTG
ATGTCATGCTTCCGGGGCTTAGCGGACTGGAAGTGCTGCGCCGCTTGAGAAAAACGGATTCGCAGACACCGGTCATATTA
TTAACGGCGCGAGACAGTATTCCTGATAAGGTAACAGGTCTGGACATCGGTGCAAATGACTATGTCACCAAGCCGTTTGA
AATCGAGGAATTGCTTGCGAGAATCAGGGCGGCGCTGCGGCAAAATGGAACAAAAACTGAAGATATCGGCACCTTTCTTA
CATATGACGATTTGCGGGTGAACGAAAAAACCCGTGAAGTGAGACGCGGAGACAAAGAGGTGGAATTAACGCCGCGGGAA
TTTGATCTGCTCGTCTATATGCTAAAGCATCCGCAGCAAGTGCTGACACGGGAGCAAATTCTAAGCTCAGTATGGGGATT
TGATTATATCGGTGATACAAATGTCGTGGACGTCTACATAAGATACATCAGAAAAAAACTGGACTATCCTTACGAAAAAC
AGCTGATCCATACGATTCGCGGGGTCGGCTATGCCATTAAGGGGTAA

Protein sequence :
MEKGHILIVEDEEKIARVLQLELEYEGYSVTIKHNGTEGLDAAAEGGYSLVLLDVMLPGLSGLEVLRRLRKTDSQTPVIL
LTARDSIPDKVTGLDIGANDYVTKPFEIEELLARIRAALRQNGTKTEDIGTFLTYDDLRVNEKTREVRRGDKEVELTPRE
FDLLVYMLKHPQQVLTREQILSSVWGFDYIGDTNVVDVYIRYIRKKLDYPYEKQLIHTIRGVGYAIKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-42 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-41 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_007533272.1 two-component response regulator YkoH NC_010079.5776364.p0 Protein 3e-46 47
ykoG YP_007533272.1 two-component response regulator YkoH NC_002952.2859858.p0 Protein 3e-46 47
ykoG YP_007533272.1 two-component response regulator YkoH NC_007622.3794948.p0 Protein 3e-46 47
ykoG YP_007533272.1 two-component response regulator YkoH NC_003923.1003417.p0 Protein 3e-46 47
ykoG YP_007533272.1 two-component response regulator YkoH NC_013450.8614146.p0 Protein 3e-46 47
ykoG YP_007533272.1 two-component response regulator YkoH NC_002951.3238224.p0 Protein 3e-46 47
ykoG YP_007533272.1 two-component response regulator YkoH NC_007793.3914065.p0 Protein 3e-46 47
ykoG YP_007533272.1 two-component response regulator YkoH NC_002758.1121390.p0 Protein 3e-46 47
ykoG YP_007533272.1 two-component response regulator YkoH HE999704.1.gene1528. Protein 1e-44 47
ykoG YP_007533272.1 two-component response regulator YkoH BAC0125 Protein 1e-44 46
ykoG YP_007533272.1 two-component response regulator YkoH AE015929.1.gene1106. Protein 8e-41 45
ykoG YP_007533272.1 two-component response regulator YkoH BAC0308 Protein 9e-44 45
ykoG YP_007533272.1 two-component response regulator YkoH BAC0197 Protein 1e-41 44
ykoG YP_007533272.1 two-component response regulator YkoH BAC0083 Protein 3e-44 43
ykoG YP_007533272.1 two-component response regulator YkoH NC_012469.1.7686381. Protein 3e-42 42
ykoG YP_007533272.1 two-component response regulator YkoH BAC0638 Protein 3e-37 42
ykoG YP_007533272.1 two-component response regulator YkoH AE016830.1.gene1681. Protein 9e-41 42
ykoG YP_007533272.1 two-component response regulator YkoH AF155139.2.orf0.gene Protein 7e-34 41
ykoG YP_007533272.1 two-component response regulator YkoH FJ349556.1.orf0.gene Protein 5e-35 41
ykoG YP_007533272.1 two-component response regulator YkoH NC_012469.1.7685629. Protein 2e-35 41
ykoG YP_007533272.1 two-component response regulator YkoH BAC0111 Protein 4e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_007533272.1 two-component response regulator YkoH VFG0596 Protein 1e-42 45
ykoG YP_007533272.1 two-component response regulator YkoH VFG1390 Protein 1e-49 45
ykoG YP_007533272.1 two-component response regulator YkoH VFG1386 Protein 8e-49 44
ykoG YP_007533272.1 two-component response regulator YkoH VFG1389 Protein 6e-42 42