Gene Information

Name : WQG_16420 (WQG_16420)
Accession : YP_007548710.1
Strain : Bibersteinia trehalosi USDA-ARS-USMARC-192
Genome accession: NC_020515
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1807164 - 1807739 bp
Length : 576 bp
Strand : -
Note : Uncharacterized proteins involved in stress response, of TerZ and cAMP-binding protein CABP1 COG2310; Tellurium resistance protein of Bacteria UniRef RepID=E2Q2T0_STRCL

DNA sequence :
ATGTCAGTATCTTTATCAAAAGGCGGTAATGTAAGCCTAAGTAAAAATGCCCCTAATTTAACTAAATTAGTGATTGGATT
AGGTTGGGATGTTCGAGCAACAGATGGTGCTGAATTTGACCTTGACGGCTCAGCATTTATTTTAGATGCGACAGGTAAAG
TACGTTCAGATGCCGATTTTATTTTTTATAACAACTTGAAATCAATTGATGCTAGTGTTGAACATACAGGTGATAATCGT
ACAGGAGCTGGCGATGGTGATGATGAAAGCATCATTGTACACCTTGACAAATTACCTACTACGGTAGAAAAAATTGCGAT
TACAGTAACTATTCATGAAGCAGAATCAAGAAAACAGAGTTTTGGTCAAGTTATTGGTGCATTTGTTCGTTGTGTCGATG
GGGCAAATAATAATGAAATTGCTCGTTTTGATTTAAGTGAGGATGCTTCAACCGAAACAGCGATGATTTTTGGTGAAATC
TATCGCCATAATGGAGAATGGAAATTCCGTGCCGTAGGACAAGGCTTTGCTGGTGGTTTAGCAGCATTAGCAAGAAATTA
CGGTATTAATATTTAA

Protein sequence :
MSVSLSKGGNVSLSKNAPNLTKLVIGLGWDVRATDGAEFDLDGSAFILDATGKVRSDADFIFYNNLKSIDASVEHTGDNR
TGAGDGDDESIIVHLDKLPTTVEKIAITVTIHEAESRKQSFGQVIGAFVRCVDGANNNEIARFDLSEDASTETAMIFGEI
YRHNGEWKFRAVGQGFAGGLAALARNYGINI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-58 70
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-57 69
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-57 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-56 69
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-51 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-47 60
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-47 60
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-47 60
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-21 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-21 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
WQG_16420 YP_007548710.1 Tellurium resistance protein BAC0389 Protein 2e-57 70
WQG_16420 YP_007548710.1 Tellurium resistance protein BAC0390 Protein 4e-51 62
WQG_16420 YP_007548710.1 Tellurium resistance protein BAC0392 Protein 3e-21 41