Gene Information

Name : AZKH_3203 (AZKH_3203)
Accession : YP_007552468.1
Strain : Azoarcus sp. KH32C
Genome accession: NC_020516
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator, MerR family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3588000 - 3588455 bp
Length : 456 bp
Strand : +
Note : -

DNA sequence :
ATGAACAATCTGACGATCGGTGCCTTGGCGCGCGCCGCTGGAGTCGGCGTCGAAACGGTCCGCTATTACCAGCGCCGAGG
TCTGCTACCGGAACCGCAGTCGCGCAAGGGAGCGTTTCGGACCTACGGCGGCGACGAGTTGGCGCGCCTGCACTTCATCC
GGCGCGCACAGGCGCTCGGCTTCAGCCTCGACGAAATCTCCGAATTGCTGGATCTCGACGAAATGACGGACCGCGAAAAC
GCGCGCGTGTTCGCGAAGGCGAAGATTGCCGACATCGAATCGCGCGTCCGCCAGCTGGAAGAAATCCGGACTGCGCTCGA
GAGCCTCGTCAGATGCTGCGAACACTCGGATGCAGAAACGCCCTGCCCGATCCTGCATGCCCTTGCGACACCCCAGCCCC
CGTTACAACCTGCGCAAGCTGCGGCCAAACGCGCGAGCCGCAAGACGCACCGCTGA

Protein sequence :
MNNLTIGALARAAGVGVETVRYYQRRGLLPEPQSRKGAFRTYGGDELARLHFIRRAQALGFSLDEISELLDLDEMTDREN
ARVFAKAKIADIESRVRQLEEIRTALESLVRCCEHSDAETPCPILHALATPQPPLQPAQAAAKRASRKTHR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-20 48
merR AFG30124.1 MerR Not tested PAGI-2 Protein 4e-18 46
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 6e-18 46
merR AGK07025.1 MerR Not tested SGI1 Protein 9e-18 46
merR AGK07083.1 MerR Not tested SGI1 Protein 9e-18 46
merR ACK44535.1 MerR Not tested SGI1 Protein 4e-18 46
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 4e-18 46
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-18 46
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-18 46
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 9e-17 45
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-20 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZKH_3203 YP_007552468.1 putative transcriptional regulator, MerR family BAC0686 Protein 7e-20 47
AZKH_3203 YP_007552468.1 putative transcriptional regulator, MerR family BAC0688 Protein 1e-19 46
AZKH_3203 YP_007552468.1 putative transcriptional regulator, MerR family BAC0684 Protein 6e-20 46
AZKH_3203 YP_007552468.1 putative transcriptional regulator, MerR family BAC0683 Protein 1e-19 46
AZKH_3203 YP_007552468.1 putative transcriptional regulator, MerR family BAC0689 Protein 6e-19 46
AZKH_3203 YP_007552468.1 putative transcriptional regulator, MerR family BAC0232 Protein 4e-18 45
AZKH_3203 YP_007552468.1 putative transcriptional regulator, MerR family BAC0687 Protein 4e-18 45