Gene Information

Name : copR/cusR (AZKH_3915)
Accession : YP_007553175.1
Strain : Azoarcus sp. KH32C
Genome accession: NC_020516
Putative virulence/resistance : Virulence
Product : two-component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4340106 - 4340813 bp
Length : 708 bp
Strand : -
Note : -

DNA sequence :
ATGCCCCGCATGGACCGTTGGTATCAGGGAACGGAAATGAAGATACTGATCGTCGAAGATGAACTCAAGACGGGCGACTA
TCTCCGCCAGGGGTTGGTCGAGGCGGGCTTCGTCTGCGATCTGGTGCGCGACGGCATGGACGGCGTGCATTACGCGCTGA
CCGGCGAGTACGACCTGATGATCCTCGACGTGATGCTGCCCGGGCTCGACGGCTGGAGCGTGCTGCAGACGGTCCGGCGT
GCCGGACGCGAGTTCCCGGTGCTGTTCCTGACGGCGCGCGACCAGGTCGAGGACCGCGTGCGCGGGCTGGAGCTCGGTGC
GGACGATTATCTCGTCAAGCCTTTTGCGTTCTCCGAACTGCTCGCCCGCGTGCGAACGCTCCTGCGCCGTGGCAAGTCGA
AGGAGCCGGAGGTGCTACGCGTGGCGGACCTGGAGCTCGACCTGCTGCGCCGGCGCGTGACGCGGGCTGGCCAGCGCATC
GATCTCACTGCGAAGGAATTCGGCCTGCTCGAGTTGCTGTTGCGACGCCAGGGCGAGGTGCTGCCGCGCTCGCTGATCGC
CTCGCAGGTGTGGGACATGAATTTCGACAGCGACACCAATGTCATCGAAGTGGCCGTGCGCCGCCTGCGCGCGAAGGTCG
ATGAGCCGTTCGAACCCAAGCTCATCCATACGGTGCGCGGCATGGGTTACGTGCTCGAGGCGCAGTGA

Protein sequence :
MPRMDRWYQGTEMKILIVEDELKTGDYLRQGLVEAGFVCDLVRDGMDGVHYALTGEYDLMILDVMLPGLDGWSVLQTVRR
AGREFPVLFLTARDQVEDRVRGLELGADDYLVKPFAFSELLARVRTLLRRGKSKEPEVLRVADLELDLLRRRVTRAGQRI
DLTAKEFGLLELLLRRQGEVLPRSLIASQVWDMNFDSDTNVIEVAVRRLRAKVDEPFEPKLIHTVRGMGYVLEAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-53 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-52 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 4e-65 72
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 2e-67 72
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 4e-66 70
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 7e-64 67
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 7e-63 67
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 1e-62 64
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 4e-58 63
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 5e-24 42
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-30 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-30 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-30 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-30 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-30 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-30 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-30 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-30 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 4e-25 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-26 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-26 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-26 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-26 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-26 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-26 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-26 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-26 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-26 41
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 7e-54 59
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 4e-38 47
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 7e-30 43
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family VFG0473 Protein 2e-31 42
copR/cusR YP_007553175.1 two-component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 1e-30 42