Gene Information

Name : yedW (ECMDS42_1596)
Accession : YP_007557228.1
Strain : Escherichia coli K-12
Genome accession: NC_020518
Putative virulence/resistance : Virulence
Product : predicted DNA-binding response regulator in two-component system withYedV
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1674967 - 1675638 bp
Length : 672 bp
Strand : -
Note : -

DNA sequence :
ATGAAGATTCTACTTATTGAAGATAATCAAAGGACCCAGGAATGGGTAACGCAGGGGCTTTCCGAAGCGGGTTATGTCAT
CGATGCCGTTTCTGATGGCAGAGATGGGCTTTATCTTGCGCTGAAGGATGATTATGCATTGATCATTCTGGATATTATGC
TTCCGGGTATGGATGGCTGGCAGATCTTACAAACGTTAAGAACAGCAAAGCAAACCCCTGTTATTTGCCTTACTGCAAGG
GATTCTGTCGATGACAGAGTCAGAGGGCTGGACAGTGGGGCAAATGATTATCTGGTAAAACCTTTTTCATTTTCTGAGTT
GCTGGCAAGGGTTCGGGCACAATTAAGGCAACATCACGCTTTGAATTCAACATTAGAAATCAGCGGCTTAAGAATGGACT
CTGTTAGTCATAGTGTGAGCAGGGACAATATCAGTATTACACTGACGCGCAAGGAGTTTCAGTTACTTTGGCTACTGGCC
TCCAGAGCTGGCGAAATTATACCCAGAACGGTTATTGCGAGTGAAATTTGGGGAATCAACTTTGATAGTGATACCAATAC
GGTGGACGTCGCCATTCGCAGGCTCCGCGCAAAAGTTGATGATCCTTTTCCTGAAAAGCTAATTGCCACAATCCGGGGGA
TGGGCTATTCATTCGTAGCGGTAAAAAAATAA

Protein sequence :
MKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLRTAKQTPVICLTAR
DSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHALNSTLEISGLRMDSVSHSVSRDNISITLTRKEFQLLWLLA
SRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPFPEKLIATIRGMGYSFVAVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-80 76
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-80 75

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV BAC0125 Protein 7e-59 57
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV BAC0197 Protein 4e-56 56
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV BAC0083 Protein 3e-54 54
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV BAC0308 Protein 3e-52 53
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV BAC0111 Protein 9e-56 52
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV BAC0638 Protein 6e-49 52
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV BAC0347 Protein 4e-50 49
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV NC_003923.1003417.p0 Protein 7e-39 42
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV NC_013450.8614146.p0 Protein 7e-39 42
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV NC_002951.3238224.p0 Protein 7e-39 42
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV NC_007793.3914065.p0 Protein 7e-39 42
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV NC_002758.1121390.p0 Protein 7e-39 42
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV NC_010079.5776364.p0 Protein 7e-39 42
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV NC_002952.2859858.p0 Protein 7e-39 42
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV NC_007622.3794948.p0 Protein 7e-39 42
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV AE015929.1.gene1106. Protein 8e-34 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_007557228.1 predicted DNA-binding response regulator in two-component system withYedV VFG0596 Protein 6e-81 76