Gene Information

Name : CgtR2 (WA5_0839)
Accession : YP_007560098.1
Strain : Corynebacterium glutamicum ATCC 13032
Genome accession: NC_020519
Putative virulence/resistance : Virulence
Product : two-component system, response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 928116 - 928814 bp
Length : 699 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATTTTAGTTGTTGATGACGAGCAAGCTGTACGTGACTCCTTGCGACGTTCCCTTTCGTTCAACGGATACAACGT
TGTTCTCGCAGAAGACGGCATCCAAGCACTAGAGATGATTGACAAGGAACAGCCTGCTTTGGTGATCCTCGATGTCATGA
TGCCTGGTATGGACGGACTTGAGGTCTGTCGCCACCTTCGCAGCGAAGGCGATGATCGGCCAATTCTTATTCTTACTGCC
CGCGATAATGTTTCTGATCGTGTTGGTGGCCTCGATGCAGGCGCAGATGACTATTTGGCTAAACCATTTGCTCTTGAAGA
GCTGTTGGCGCGCGTCCGTTCACTGGTGCGTCGCTCTGCAGTGGAATCAAATCAGAGTTCCAGCATTGAACAGGCTCTAT
TATCTTGTGGCGATTTGACGCTTGACCCAGAAAGTCGAGATGTCTACCGCAACGGACGCGCCATCAGCCTTACTCGAACA
GAGTTCGCGCTCCTGCAATTGCTCCTCAAAAACCAAAGGAAAGTGCTCACTCGCGCCCAGATTTTGGAAGAGGTATGGGG
CTGCGATTTCCCCACTTCAGGCAATGCCCTCGAGGTCTACATTGGATACCTTCGACGCAAGACTGAATTGGAAGGAGAAG
ACCGCCTGATCCATACAGTACGAGGAGTCGGATACGTCCTGCGAGAGACCGCTCCGTGA

Protein sequence :
MKILVVDDEQAVRDSLRRSLSFNGYNVVLAEDGIQALEMIDKEQPALVILDVMMPGMDGLEVCRHLRSEGDDRPILILTA
RDNVSDRVGGLDAGADDYLAKPFALEELLARVRSLVRRSAVESNQSSSIEQALLSCGDLTLDPESRDVYRNGRAISLTRT
EFALLQLLLKNQRKVLTRAQILEEVWGCDFPTSGNALEVYIGYLRRKTELEGEDRLIHTVRGVGYVLRETAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-32 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CgtR2 YP_007560098.1 two-component system, response regulator BAC0125 Protein 2e-36 45
CgtR2 YP_007560098.1 two-component system, response regulator BAC0083 Protein 8e-33 44
CgtR2 YP_007560098.1 two-component system, response regulator HE999704.1.gene1528. Protein 5e-35 44
CgtR2 YP_007560098.1 two-component system, response regulator BAC0308 Protein 3e-32 44
CgtR2 YP_007560098.1 two-component system, response regulator BAC0197 Protein 3e-33 44
CgtR2 YP_007560098.1 two-component system, response regulator BAC0487 Protein 2e-20 43
CgtR2 YP_007560098.1 two-component system, response regulator NC_002951.3238224.p0 Protein 2e-32 41
CgtR2 YP_007560098.1 two-component system, response regulator NC_007793.3914065.p0 Protein 2e-32 41
CgtR2 YP_007560098.1 two-component system, response regulator NC_002758.1121390.p0 Protein 2e-32 41
CgtR2 YP_007560098.1 two-component system, response regulator NC_010079.5776364.p0 Protein 2e-32 41
CgtR2 YP_007560098.1 two-component system, response regulator NC_002952.2859858.p0 Protein 2e-32 41
CgtR2 YP_007560098.1 two-component system, response regulator NC_007622.3794948.p0 Protein 2e-32 41
CgtR2 YP_007560098.1 two-component system, response regulator NC_003923.1003417.p0 Protein 2e-32 41
CgtR2 YP_007560098.1 two-component system, response regulator NC_013450.8614146.p0 Protein 2e-32 41
CgtR2 YP_007560098.1 two-component system, response regulator BAC0638 Protein 4e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CgtR2 YP_007560098.1 two-component system, response regulator VFG1390 Protein 6e-69 66
CgtR2 YP_007560098.1 two-component system, response regulator VFG1386 Protein 6e-45 47
CgtR2 YP_007560098.1 two-component system, response regulator VFG1389 Protein 4e-38 47
CgtR2 YP_007560098.1 two-component system, response regulator VFG0596 Protein 6e-33 43