Gene Information

Name : NJAUSS_1414 (NJAUSS_1414)
Accession : YP_007571357.1
Strain : Streptococcus suis SC070731
Genome accession: NC_020526
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L31 type B
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1504759 - 1505040 bp
Length : 282 bp
Strand : -
Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g

DNA sequence :
ATGGCTCGGAAAGAGTCCATGGCAGAAAGGAATTTTAAAATGAAAAAAGATATCCATCCAGAATATCGCACTGTTGTCTT
CATGGACACAACTACTGGCTACAAGTTCCTTAGCGGTTCAACTAAGAAATCTAACGAAACAGTTGAATTCGAAGGTGAAA
CTTACCCATTGATCCGTGTGGAAATTTCATCAGACTCACACCCATTCTATACTGGACGTCAAAAGTTCACTCAAGCAGAT
GGACGTGTGGATCGCTTCAACAAAAAATACGGTCTCAAATAA

Protein sequence :
MARKESMAERNFKMKKDIHPEYRTVVFMDTTTGYKFLSGSTKKSNETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQAD
GRVDRFNKKYGLK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmE2 NP_287095.1 50S ribosomal protein L31 Not tested TAI Protein 9e-15 49
rpmE2 NP_286687.1 50S ribosomal protein L31 Not tested TAI Protein 9e-15 49