Gene Information

Name : SM2011_a6510 (SM2011_a6510)
Accession : YP_007573148.1
Strain :
Genome accession: NC_020527
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1222990 - 1223307 bp
Length : 318 bp
Strand : -
Note : corresponds to SMa6510

DNA sequence :
TTGCGCTTATGTGGTGCACCACATAAGCGCAAAGGGGTAGAAGGTTTGGCTGCGCTTGCGCAGGATGTGCTGCGCCAGAA
GCCGACGGGAGGTGCAGTCTTCGCGTTTCGAGGCAGACGGGGCGATCGTTTGAAACTCCTGTATTTTGATGGCCAGGGCT
TCTGCCTGTACTATAAAATTTTGCAGAGGGGGCGTTTTCCATGGCCTTCAGCAGCCGATGGAACGGCCCGGCTGACAACC
GCGCAACTGGCCATGCTTTGGGAAGGGATTGATTGGCGACGGCCCAACTGGGGCGCTCCGCCGGCGCGTGTCGGTTGA

Protein sequence :
MRLCGAPHKRKGVEGLAALAQDVLRQKPTGGAVFAFRGRRGDRLKLLYFDGQGFCLYYKILQRGRFPWPSAADGTARLTT
AQLAMLWEGIDWRRPNWGAPPARVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-13 56
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-13 56
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-13 56
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-13 56
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-13 56
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-13 56
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-13 56
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-13 56
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-13 56
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-13 56
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-13 55
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-13 55
unnamed AAL08461.1 unknown Not tested SRL Protein 6e-13 54
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-10 53
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-07 52
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-14 47
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-14 47
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-13 46
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-10 45
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-11 45
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-11 45
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 7e-10 45
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 7e-10 45
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 4e-12 44
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 4e-12 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SM2011_a6510 YP_007573148.1 hypothetical protein VFG0792 Protein 1e-13 56
SM2011_a6510 YP_007573148.1 hypothetical protein VFG1709 Protein 1e-13 56
SM2011_a6510 YP_007573148.1 hypothetical protein VFG1698 Protein 8e-14 55
SM2011_a6510 YP_007573148.1 hypothetical protein VFG1052 Protein 2e-13 54
SM2011_a6510 YP_007573148.1 hypothetical protein VFG1517 Protein 2e-07 52
SM2011_a6510 YP_007573148.1 hypothetical protein VFG1665 Protein 4e-14 46
SM2011_a6510 YP_007573148.1 hypothetical protein VFG1737 Protein 3e-11 45