Gene Information

Name : SAI7S6_1000170 (SAI7S6_1000170)
Accession : YP_007584591.1
Strain : Staphylococcus aureus ST228 (isolate=18412)
Genome accession: NC_020537
Putative virulence/resistance : Virulence
Product : Response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 24928 - 25635 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
ATGCAAATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTTAACTTAAAAAAAGA
AGGATACGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGACTTAATTTATGAAGAAGAACCAGACATCGTATTAC
TAGATATCATGTTACCTGGTCGTGATGGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATAATAATG
CTTACTGCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTAACGAAACCGTTTAG
TACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCATTACTCACAACCAGCACAAGACACTGGAAATGTAA
CGAATGAAATCACAATTAAAGATATTGTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTA
ACACATCGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAACATTTATTACAAAC
AGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTAACGATTCGTCGTTTACGTGAAAAGATTGAAGATG
ATCCGTCACATCCTGAATATATTGTGACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG

Protein sequence :
MQMARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIM
LTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIEL
THREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAI7S6_1000170 YP_007584591.1 Response regulator NC_012469.1.7685629. Protein 1e-70 63
SAI7S6_1000170 YP_007584591.1 Response regulator NC_003923.1003749.p0 Protein 2e-56 53
SAI7S6_1000170 YP_007584591.1 Response regulator NC_002952.2859905.p0 Protein 2e-56 52
SAI7S6_1000170 YP_007584591.1 Response regulator NC_009782.5559369.p0 Protein 3e-56 52
SAI7S6_1000170 YP_007584591.1 Response regulator NC_002951.3237708.p0 Protein 3e-56 52
SAI7S6_1000170 YP_007584591.1 Response regulator NC_002758.1121668.p0 Protein 3e-56 52
SAI7S6_1000170 YP_007584591.1 Response regulator NC_007622.3794472.p0 Protein 2e-56 52
SAI7S6_1000170 YP_007584591.1 Response regulator NC_009641.5332272.p0 Protein 3e-56 52
SAI7S6_1000170 YP_007584591.1 Response regulator NC_013450.8614421.p0 Protein 3e-56 52
SAI7S6_1000170 YP_007584591.1 Response regulator NC_007793.3914279.p0 Protein 3e-56 52
SAI7S6_1000170 YP_007584591.1 Response regulator NC_002745.1124361.p0 Protein 3e-56 52
SAI7S6_1000170 YP_007584591.1 Response regulator HE999704.1.gene2815. Protein 6e-52 50
SAI7S6_1000170 YP_007584591.1 Response regulator NC_012469.1.7686381. Protein 4e-47 49
SAI7S6_1000170 YP_007584591.1 Response regulator AE016830.1.gene1681. Protein 4e-48 46
SAI7S6_1000170 YP_007584591.1 Response regulator AE000516.2.gene3505. Protein 8e-42 46
SAI7S6_1000170 YP_007584591.1 Response regulator AM180355.1.gene1830. Protein 2e-45 45
SAI7S6_1000170 YP_007584591.1 Response regulator NC_005054.2598277.p0 Protein 3e-42 44
SAI7S6_1000170 YP_007584591.1 Response regulator NC_014475.1.orf0.gen Protein 3e-42 44
SAI7S6_1000170 YP_007584591.1 Response regulator AF130997.1.orf0.gene Protein 1e-41 44
SAI7S6_1000170 YP_007584591.1 Response regulator FJ349556.1.orf0.gene Protein 6e-41 44
SAI7S6_1000170 YP_007584591.1 Response regulator AF155139.2.orf0.gene Protein 2e-38 43
SAI7S6_1000170 YP_007584591.1 Response regulator DQ212986.1.gene4.p01 Protein 1e-41 42
SAI7S6_1000170 YP_007584591.1 Response regulator NC_007793.3914065.p0 Protein 7e-36 41
SAI7S6_1000170 YP_007584591.1 Response regulator NC_002758.1121390.p0 Protein 7e-36 41
SAI7S6_1000170 YP_007584591.1 Response regulator NC_010079.5776364.p0 Protein 7e-36 41
SAI7S6_1000170 YP_007584591.1 Response regulator NC_002952.2859858.p0 Protein 7e-36 41
SAI7S6_1000170 YP_007584591.1 Response regulator NC_007622.3794948.p0 Protein 7e-36 41
SAI7S6_1000170 YP_007584591.1 Response regulator NC_003923.1003417.p0 Protein 7e-36 41
SAI7S6_1000170 YP_007584591.1 Response regulator NC_013450.8614146.p0 Protein 7e-36 41
SAI7S6_1000170 YP_007584591.1 Response regulator NC_002951.3238224.p0 Protein 7e-36 41
SAI7S6_1000170 YP_007584591.1 Response regulator AE015929.1.gene1106. Protein 9e-31 41
SAI7S6_1000170 YP_007584591.1 Response regulator HE999704.1.gene1528. Protein 4e-35 41
SAI7S6_1000170 YP_007584591.1 Response regulator AF162694.1.orf4.gene Protein 6e-37 41
SAI7S6_1000170 YP_007584591.1 Response regulator CP001918.1.gene5135. Protein 8e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAI7S6_1000170 YP_007584591.1 Response regulator VFG1702 Protein 2e-37 41