Gene Information

Name : G432_13830 (G432_13830)
Accession : YP_007617080.1
Strain : Sphingomonas sp. MM-1
Genome accession: NC_020561
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2922145 - 2922810 bp
Length : 666 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGCGTACTGATTGTCGAGGACGAGCCGAATCTCGGCCGCCAGCTTCGCGCCACGCTCGAAGGAGCGGGCTATGCCGT
CGATCTGGCCACCGATGGCGAGGACGGCCACTTCCTGGGCTCCACCGAAAATTACGATGCGATCATCCTCGATCTGGGCC
TGCCCAAGCTCGACGGGCTGACCGTGCTCGACAGGTGGCGCAAGGAGGGCAAGGAAACCCCCGTGCTGGTGCTGACGGCG
CGGGACAGCTGGTCGGACAAGGTGGCGGGCCTCGATGCCGGCGCCGACGACTATCTCGCCAAGCCCTTCCAGACGGAGGA
GCTGATCGCCCGGCTGCGCGCGCTGATCCGCCGCGCCTCGGGCAATGCTTCGTCCGAGCTGGTGGCGGGCGACGTGCGGC
TCGACACGCGATCGGGCAAGGTCACGCTGGCCGGCGAGCCGGTGAAGATGACCGCGCAGGAATATAAGCTGCTGAGCTAC
CTGATGCACCACAAGGGCAAGGTGGTGAGCCGCACCGAGCTGATCGAGCATATCTACGACCAGGATTTCGATCGCGATTC
GAACACGATCGAGGTGTTCGTCACCCGCATCCGCAAGAAGCTGGGCCAGGATGTGATCACCACCATCCGGGGCCTGGGCT
ACAGCCTCGAGGACCCGGACGCCTGA

Protein sequence :
MRVLIVEDEPNLGRQLRATLEGAGYAVDLATDGEDGHFLGSTENYDAIILDLGLPKLDGLTVLDRWRKEGKETPVLVLTA
RDSWSDKVAGLDAGADDYLAKPFQTEELIARLRALIRRASGNASSELVAGDVRLDTRSGKVTLAGEPVKMTAQEYKLLSY
LMHHKGKVVSRTELIEHIYDQDFDRDSNTIEVFVTRIRKKLGQDVITTIRGLGYSLEDPDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
G432_13830 YP_007617080.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-30 46
G432_13830 YP_007617080.1 two component transcriptional regulator BAC0487 Protein 3e-25 45
G432_13830 YP_007617080.1 two component transcriptional regulator CP000647.1.gene1136. Protein 2e-31 44
G432_13830 YP_007617080.1 two component transcriptional regulator CP001918.1.gene2526. Protein 4e-30 44
G432_13830 YP_007617080.1 two component transcriptional regulator NC_002695.1.913289.p Protein 1e-30 44
G432_13830 YP_007617080.1 two component transcriptional regulator CP000034.1.gene2022. Protein 1e-30 44
G432_13830 YP_007617080.1 two component transcriptional regulator BAC0197 Protein 3e-26 44
G432_13830 YP_007617080.1 two component transcriptional regulator BAC0530 Protein 2e-31 44
G432_13830 YP_007617080.1 two component transcriptional regulator BAC0083 Protein 3e-23 43
G432_13830 YP_007617080.1 two component transcriptional regulator CP004022.1.gene1005. Protein 4e-31 43
G432_13830 YP_007617080.1 two component transcriptional regulator BAC0308 Protein 4e-23 43
G432_13830 YP_007617080.1 two component transcriptional regulator CP001138.1.gene1939. Protein 7e-31 43
G432_13830 YP_007617080.1 two component transcriptional regulator BAC0638 Protein 2e-18 43
G432_13830 YP_007617080.1 two component transcriptional regulator BAC0347 Protein 2e-21 42
G432_13830 YP_007617080.1 two component transcriptional regulator BAC0111 Protein 6e-26 42
G432_13830 YP_007617080.1 two component transcriptional regulator BAC0125 Protein 3e-25 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
G432_13830 YP_007617080.1 two component transcriptional regulator VFG0473 Protein 1e-22 43
G432_13830 YP_007617080.1 two component transcriptional regulator VFG0475 Protein 7e-31 43
G432_13830 YP_007617080.1 two component transcriptional regulator VFG1390 Protein 3e-22 41