Gene Information

Name : G432_01535 (G432_01535)
Accession : YP_007614631.1
Strain : Sphingomonas sp. MM-1
Genome accession: NC_020561
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 338414 - 339112 bp
Length : 699 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGCCCGTGCCCGCCTGCTGCTTGTCGAGGATGATGCCGCGCTCGCCGAACTGCTGATCTGGCATTTCGAGCGCGAGGA
ATTCGAGGTCGAACATACGCCGGACGGCGAGGAGGCGCTGCTCCTTGCCCAGGAAAGCCCGCCCGATCTCGTCCTGCTGG
ACTGGATGATCGAGGGTCTTTCCGGCATCGAGGTCTGTCGCCGCCTGCGCCGGCTCAACGATACGGCCAACGTGCCGATC
ATCATGCTCACCGCGCGCGGCGAGGAGGAGGATCGCGTGCGCGGGCTGGAAACCGGCGCCGACGATTATGTCACCAAGCC
CTTCTCCCCGCGCGAGCTGGTCGCCCGGGTCGGCGCGGTGCTGCGCCGCGTGCGCCCGGCGCTGGCCGGGGAACGGCTGT
CCTATTCGGATATCGAGATGGATACGGTGAGCCACAAGGTCCGCCGCGACGGGGCGACGGTGCCGCTCGGCCCCACCGAA
TTCCGCCTGCTCAAGCATTTCCTCGAGCATCCGGGCCGCGTCTTCTCGCGCGAGCGGCTGCTGGATTCGGTCTGGGGCCG
CGACAGCGATATCGAGCCGCGCACGGTGGACGTGCATATCCGCCGGCTACGCAAGGCGATCAACGATGGCGGCCGGCCCG
ATATCATCCGCACCGTCCGCTCAGCCGGCTATGCCCTGGACGTCGAGGGCGCGCTATAG

Protein sequence :
MARARLLLVEDDAALAELLIWHFEREEFEVEHTPDGEEALLLAQESPPDLVLLDWMIEGLSGIEVCRRLRRLNDTANVPI
IMLTARGEEEDRVRGLETGADDYVTKPFSPRELVARVGAVLRRVRPALAGERLSYSDIEMDTVSHKVRRDGATVPLGPTE
FRLLKHFLEHPGRVFSRERLLDSVWGRDSDIEPRTVDVHIRRLRKAINDGGRPDIIRTVRSAGYALDVEGAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 1e-22 43
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 1e-22 43
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 1e-22 43
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 1e-22 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-24 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 6e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
G432_01535 YP_007614631.1 two component transcriptional regulator AE000516.2.gene3505. Protein 6e-35 48
G432_01535 YP_007614631.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-30 43
G432_01535 YP_007614631.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-30 43
G432_01535 YP_007614631.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-30 43
G432_01535 YP_007614631.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-30 43
G432_01535 YP_007614631.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-30 43
G432_01535 YP_007614631.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-30 43
G432_01535 YP_007614631.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-30 43
G432_01535 YP_007614631.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-30 43
G432_01535 YP_007614631.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-30 43
G432_01535 YP_007614631.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-30 43
G432_01535 YP_007614631.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 9e-29 42
G432_01535 YP_007614631.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-28 42
G432_01535 YP_007614631.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-28 42
G432_01535 YP_007614631.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-29 42
G432_01535 YP_007614631.1 two component transcriptional regulator BAC0197 Protein 5e-22 41
G432_01535 YP_007614631.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
G432_01535 YP_007614631.1 two component transcriptional regulator VFG0596 Protein 5e-25 42
G432_01535 YP_007614631.1 two component transcriptional regulator VFG1390 Protein 1e-28 41
G432_01535 YP_007614631.1 two component transcriptional regulator VFG1389 Protein 9e-25 41