Gene Information

Name : TOL_0540 (TOL_0540)
Accession : YP_007681218.1
Strain : Thalassolituus oleivorans MIL-1
Genome accession: NC_020888
Putative virulence/resistance : Resistance
Product : resistance operon regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 573077 - 573481 bp
Length : 405 bp
Strand : +
Note : -

DNA sequence :
ATGAACGAAAACCACACCATTGGCCAGCTGGCCAAGACAGCAGGTGTCAACGTCGAAACCATCCGCTACTACGAACGCCG
TGGTTTGATCCGTCAACCACCCAAACCCGCAGAGGGATACCGTACCTACCCAAACGCAACCTTGGCTCGGATTTTATTCA
TCAAACGCGCCCAGGAACTGGGTTTTACGCTGGAGGAGATCAACAACCTGCTGTCATTGGGCGAGTCGCATTGCTCGGAA
GTCCAGGAGCTGGCCGAAGCAAAGCTGGCCAGCGTGCGTGAAAAAATTAACGATCTACACCGCCTGCAACAGGTGTTGGA
AGAGCTCGTCACACAGTGCCGGACCAATCCTGACAATGCGGCATGTCCTATTGTTGAATCCCTCCAACCTGCTCCTCGTC
AATAA

Protein sequence :
MNENHTIGQLAKTAGVNVETIRYYERRGLIRQPPKPAEGYRTYPNATLARILFIKRAQELGFTLEEINNLLSLGESHCSE
VQELAEAKLASVREKINDLHRLQQVLEELVTQCRTNPDNAACPIVESLQPAPRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AGK07083.1 MerR Not tested SGI1 Protein 4e-31 52
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-31 52
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-31 52
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-31 52
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-31 52
merR AGK07025.1 MerR Not tested SGI1 Protein 4e-31 52
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-31 51
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 3e-31 51
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-31 50
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 4e-28 47
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 3e-28 45
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 4e-24 41
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 3e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TOL_0540 YP_007681218.1 resistance operon regulatory protein BAC0688 Protein 9e-32 54
TOL_0540 YP_007681218.1 resistance operon regulatory protein BAC0686 Protein 2e-31 53
TOL_0540 YP_007681218.1 resistance operon regulatory protein BAC0687 Protein 3e-31 52
TOL_0540 YP_007681218.1 resistance operon regulatory protein BAC0232 Protein 3e-31 52
TOL_0540 YP_007681218.1 resistance operon regulatory protein BAC0684 Protein 1e-31 51
TOL_0540 YP_007681218.1 resistance operon regulatory protein BAC0683 Protein 1e-31 51
TOL_0540 YP_007681218.1 resistance operon regulatory protein BAC0689 Protein 1e-30 51
TOL_0540 YP_007681218.1 resistance operon regulatory protein BAC0682 Protein 2e-26 47