Gene Information

Name : TOL_0542 (TOL_0542)
Accession : YP_007681220.1
Strain : Thalassolituus oleivorans MIL-1
Genome accession: NC_020888
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic component
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 573935 - 574222 bp
Length : 288 bp
Strand : +
Note : -

DNA sequence :
ATGCAGAAAATCATTCTCGGTCTCGTATTCACCATCGCCAGCTTCTCGGCCTGGGCCAAGCCACAAACCATCACGCTGGA
TCTGCCAACCATGAACTGTGCCATGTGCCCGATCACGGTCAAAAAGGCACTCACCAAGGTCCAAGGCGTAACAAAAGCCG
AGGTCAGTTATGAGCATAAGCAAGCCGTAGTAACCTTTGAGGATTCCCTGACCAACGCTGACAGATTGGTCGAAGCGACC
ACCCATGCCGGTTATTCATCGACCATCGTGAAAACGGAAACACCATGA

Protein sequence :
MQKIILGLVFTIASFSAWAKPQTITLDLPTMNCAMCPITVKKALTKVQGVTKAEVSYEHKQAVVTFEDSLTNADRLVEAT
THAGYSSTIVKTETP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 5e-19 63
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 9e-17 61
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 6e-17 56
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 4e-17 56
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-17 55
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-17 55
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-17 55
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-17 55
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-17 55
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-17 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TOL_0542 YP_007681220.1 mercuric transport protein periplasmic component BAC0675 Protein 1e-15 58
TOL_0542 YP_007681220.1 mercuric transport protein periplasmic component BAC0678 Protein 2e-17 55
TOL_0542 YP_007681220.1 mercuric transport protein periplasmic component BAC0679 Protein 3e-17 55
TOL_0542 YP_007681220.1 mercuric transport protein periplasmic component BAC0674 Protein 3e-14 49
TOL_0542 YP_007681220.1 mercuric transport protein periplasmic component BAC0231 Protein 4e-17 47