Gene Information

Name : CMN_01013 (CMN_01013)
Accession : YP_007685309.1
Strain : Clavibacter michiganensis NCPPB 2581
Genome accession: NC_020891
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1042763 - 1043443 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGACAGCACGGATCCTGGTGGTCGACGACGACACCGCGCTCGCCGAGATGATCGGCATCGTCCTGCGCACCGAGGGGTT
CGAGCCCTCCTTCTGCGGGGACGGCGGCCAGGCGCTCGCCGCGTTCCACGAGGCGAAGCCCGACCTGGTGCTGCTCGACC
TCATGCTCCCCGGCCTCGACGGCATCCAGGTGTGCGACCTCATCCGCGCCGAGTCGGGCGTGCCCATCATCATGCTCACC
GCGAAGTCCGACACGGCCGACGTCGTCAAGGGCCTCGAGTCCGGCGCCGACGACTACATCGTCAAGCCCTTCAACCCGAA
GGAGCTCGTCGCCCGCATCCGCACGCGCCTGCGCCCCGCGGCCGCCGCGTCGCCCGGGCTCCTCCAGGTCGGCGACCTCG
TCGTCGACGTCGAGGGCCACGAGGTGCGCCGCGGCGAGGAGCGGATCAACCTCACGCCCCTCGAGTTCGACCTCCTGCAC
GCGCTCGCCAGCCGCCCGCAGCAGGTGTTCACGCGCGAGATGCTCCTCGAGCAGGTTTGGGGCTACCAGTACAAGGCCGA
CACGCGCCTCGTCAACGTCCACGTGCAGCGACTGCGCGCGAAGGTCGAGGACGACCCGGACAACCCGCGCATCGTCATGA
CCGTCCGCGGCGTCGGCTACCGCGCGGGGGCAGCGACCTAG

Protein sequence :
MTARILVVDDDTALAEMIGIVLRTEGFEPSFCGDGGQALAAFHEAKPDLVLLDLMLPGLDGIQVCDLIRAESGVPIIMLT
AKSDTADVVKGLESGADDYIVKPFNPKELVARIRTRLRPAAAASPGLLQVGDLVVDVEGHEVRRGEERINLTPLEFDLLH
ALASRPQQVFTREMLLEQVWGYQYKADTRLVNVHVQRLRAKVEDDPDNPRIVMTVRGVGYRAGAAT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CMN_01013 YP_007685309.1 two-component system response regulator AE000516.2.gene3505. Protein 5e-54 68
CMN_01013 YP_007685309.1 two-component system response regulator BAC0125 Protein 2e-25 46
CMN_01013 YP_007685309.1 two-component system response regulator NC_012469.1.7685629. Protein 3e-32 45
CMN_01013 YP_007685309.1 two-component system response regulator HE999704.1.gene1528. Protein 5e-23 44
CMN_01013 YP_007685309.1 two-component system response regulator NC_012469.1.7686381. Protein 9e-31 42
CMN_01013 YP_007685309.1 two-component system response regulator NC_002952.2859905.p0 Protein 9e-34 42
CMN_01013 YP_007685309.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-33 42
CMN_01013 YP_007685309.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-33 42
CMN_01013 YP_007685309.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-33 42
CMN_01013 YP_007685309.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-33 42
CMN_01013 YP_007685309.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-33 42
CMN_01013 YP_007685309.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-33 42
CMN_01013 YP_007685309.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-33 42
CMN_01013 YP_007685309.1 two-component system response regulator NC_007622.3794472.p0 Protein 8e-34 42
CMN_01013 YP_007685309.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-33 42
CMN_01013 YP_007685309.1 two-component system response regulator CP000034.1.gene3671. Protein 4e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CMN_01013 YP_007685309.1 two-component system response regulator VFG1389 Protein 7e-25 45
CMN_01013 YP_007685309.1 two-component system response regulator VFG1390 Protein 6e-27 43
CMN_01013 YP_007685309.1 two-component system response regulator VFG0596 Protein 2e-22 41