Gene Information

Name : OAN307_63p00500 (OAN307_63p00500)
Accession : YP_007697727.1
Strain :
Genome accession: NC_020907
Putative virulence/resistance : Unknown
Product : putative IS66-family mobile element associated protein Orf2
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 51010 - 51357 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
ATGATCCCTGTCTTGGCTGATGCGAAGATCTGGCTTGCGGCAGGTGTTACGGATATGCGGCGTGGGTTCAACGGACTTGC
AGCTCAAACCGATCAAGTTCTGGCAGGTGATCCATACTCGGGCCATCTGTTTTTGTTCCGAGGTCGTAGAGGCGATCAGA
TCAAAGTCATATGGTGGGATGGACAGGGCGCATGCCTGTTTACCAAGCGCCTTGAGCGAGGTCGATTTGTGTGGCCCGCT
GCTCGTGAGGGCAAGATCAGCTTAAGCCGTGCACAACTCGCCATGCTGATGGAGGGCATAGACTGGCGCATGCCGCAAAA
AAAATGGCAACCTAGCAAGGTAGGATAA

Protein sequence :
MIPVLADAKIWLAAGVTDMRRGFNGLAAQTDQVLAGDPYSGHLFLFRGRRGDQIKVIWWDGQGACLFTKRLERGRFVWPA
AREGKISLSRAQLAMLMEGIDWRMPQKKWQPSKVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-35 65
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-35 65
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-34 64
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-32 64
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-32 64
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-32 64
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-32 64
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-32 64
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-32 64
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-32 64
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-32 64
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-31 64
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-32 64
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-31 64
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-32 64
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-32 63
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-24 61
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-34 60
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-33 59
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-33 59
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 8e-33 57
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 8e-33 57
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-27 57
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-30 56
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-30 56

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OAN307_63p00500 YP_007697727.1 putative IS66-family mobile element associated protein Orf2 VFG1665 Protein 4e-35 64
OAN307_63p00500 YP_007697727.1 putative IS66-family mobile element associated protein Orf2 VFG1709 Protein 8e-33 64
OAN307_63p00500 YP_007697727.1 putative IS66-family mobile element associated protein Orf2 VFG0792 Protein 8e-33 64
OAN307_63p00500 YP_007697727.1 putative IS66-family mobile element associated protein Orf2 VFG1698 Protein 1e-32 64
OAN307_63p00500 YP_007697727.1 putative IS66-family mobile element associated protein Orf2 VFG1052 Protein 1e-32 63
OAN307_63p00500 YP_007697727.1 putative IS66-family mobile element associated protein Orf2 VFG1517 Protein 5e-25 61
OAN307_63p00500 YP_007697727.1 putative IS66-family mobile element associated protein Orf2 VFG1737 Protein 3e-34 60