Gene Information

Name : XNR_2416 (XNR_2416)
Accession : YP_007745791.1
Strain : Streptomyces albus J1074
Genome accession: NC_020990
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2809374 - 2809949 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGCTGTAAGCCTGTCCAAGGGCGGCAACGTCTCGCTCACCAAGGAGGCTCCCGGCCTGACCGCCGTCACGGTCGGCCT
CGGCTGGGACGTCCGCACCACCACCGGTACGGACTTCGACCTCGATGCCTCCGCCATCGCGGTCAACGCCGAGGGCAAGG
TCTACTCCGACGGCCACTTCGTCTTCTTCAACAACAAGCAGACGCCGGACCAGACCATCGTCCACACCGGCGACAACCGC
ACCGGCGAGGGCGACGGCGACGACGAGGCGATCAACGTCAACCTCGCCGGCCTCCCCGCCGACGTCGACAAGATCGTCTT
CCCGGTCTCGATCTACGACGCGGAGTCCCGCTCGCAGAACTTCGGCCAGGTGCGCAACGCCTACATCCGCATCGTCAACC
AGGCCGGCGGCACCGAGATCGCCCGCTACGACCTGAGCGAGGACGCCGCCACCGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCCGTCGGCCAGGGTTACGCCTCGGGCCTGGTCGGCATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNAEGKVYSDGHFVFFNNKQTPDQTIVHTGDNR
TGEGDGDDEAINVNLAGLPADVDKIVFPVSIYDAESRSQNFGQVRNAYIRIVNQAGGTEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLVGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-60 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-60 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-60 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-59 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 62
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 62
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-58 61
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNR_2416 YP_007745791.1 Tellurium resistance protein TerD BAC0390 Protein 2e-59 63
XNR_2416 YP_007745791.1 Tellurium resistance protein TerD BAC0389 Protein 2e-58 62