Gene Information

Name : XNR_3997 (XNR_3997)
Accession : YP_007747335.1
Strain : Streptomyces albus J1074
Genome accession: NC_020990
Putative virulence/resistance : Virulence
Product : Two-component system response regulator AfsQ1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4541654 - 4542340 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGGCGGGCGTGCCTTCCCTGTTGCTGATCGAGGACGACGACGCCATCCGTACCGCCCTGGAGCTGTCGCTGACACGCCA
GGGGCATCGGGTGGCGACCGCTGCCACCGGCGAGGAGGGTCTGACGCTCCTGCGCGAGCAGCGGCCGGACCTGATCGTGC
TGGACGTGATGCTGCCGGGCATCGACGGCTTCGAGGTGTGCCGGCGCATCCGCCGCACGGACCAGTTGCCGATCATCCTG
CTGACCGCGCGCAGCGACGACATCGACGTGGTGGTGGGGCTGGAGTCCGGCGCCGACGACTACGTGGTCAAGCCGGTCCA
GGGCCGGGTGCTGGACGCGCGTATCCGGGCCGTGCTGCGGCGGGGCGAGCGGGAGTCGAACGACGCGGCGGTCTTCGGGT
CGCTGGTGATCGACCGGGCCGCGATGACGGTCACGAAGAACGGCGAGGACCTGCAACTGACCCCGACCGAGCTGCGGTTG
CTCCTGGAGCTGTCCCGCAGGCCGGGGCAGGCGCTCTCCCGGCAGCAGTTGCTGCGGCTGGTCTGGGAGCACGACTACCT
CGGTGACTCGCGGCTGGTCGACGCCTGTGTGCAGCGGCTGCGCGCCAAGGTGGAGGACGTGCCGTCCTCGCCGACGCTGA
TCCGTACCGTGCGCGGCGTGGGCTACCGGCTGGACGCGCCTCAGTGA

Protein sequence :
MAGVPSLLLIEDDDAIRTALELSLTRQGHRVATAATGEEGLTLLREQRPDLIVLDVMLPGIDGFEVCRRIRRTDQLPIIL
LTARSDDIDVVVGLESGADDYVVKPVQGRVLDARIRAVLRRGERESNDAAVFGSLVIDRAAMTVTKNGEDLQLTPTELRL
LLELSRRPGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVEDVPSSPTLIRTVRGVGYRLDAPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 AE000516.2.gene3505. Protein 1e-34 47
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_002952.2859905.p0 Protein 1e-37 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_007622.3794472.p0 Protein 1e-37 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_002745.1124361.p0 Protein 2e-37 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_009782.5559369.p0 Protein 2e-37 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_002951.3237708.p0 Protein 2e-37 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_003923.1003749.p0 Protein 2e-37 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_002758.1121668.p0 Protein 2e-37 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_009641.5332272.p0 Protein 2e-37 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_013450.8614421.p0 Protein 2e-37 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_007793.3914279.p0 Protein 2e-37 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_012469.1.7685629. Protein 7e-39 44
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 BAC0197 Protein 1e-25 42
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_010079.5776364.p0 Protein 2e-31 41
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_002952.2859858.p0 Protein 2e-31 41
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_007622.3794948.p0 Protein 2e-31 41
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_003923.1003417.p0 Protein 2e-31 41
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_013450.8614146.p0 Protein 2e-31 41
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_002951.3238224.p0 Protein 2e-31 41
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_007793.3914065.p0 Protein 2e-31 41
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_002758.1121390.p0 Protein 2e-31 41
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 NC_012469.1.7686381. Protein 1e-33 41
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 CP000034.1.gene3671. Protein 9e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 VFG1389 Protein 4e-22 43
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 VFG1390 Protein 8e-28 42
XNR_3997 YP_007747335.1 Two-component system response regulator AfsQ1 VFG0596 Protein 7e-24 41