Gene Information

Name : XNR_4530 (XNR_4530)
Accession : YP_007747856.1
Strain : Streptomyces albus J1074
Genome accession: NC_020990
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5151315 - 5151890 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGTGTCACGCTTGCCAAAGGGGGAAACGTCTCCCTCTCCAAGGCCGCGCCGAACCTCACTCAGGTCCTGGTCGGCCT
CGGCTGGGATGCCCGCTCCACCACCGGCGCCCCGTTCGACCTCGACGCGAGCGCGCTGCTGTGCACCTCGGGCCGGGTGA
TGGGCGACGAGTGGTTCGTCTTCTACAACAACCTCAAGAGCCCGGACGGCTCGGTCGAGCACACCGGCGACAACCTCACG
GGTGAGGGGGACGGCGACGACGAGTCCCTGCTGGTCGACCTCGCCCAGGTACCCGCCCACTGCGACAAGATCGTCTTCCC
CGTCTCGATCCATGAGGCCGACGTCAGGGGCCAGACGTTCGGGCAGGTGAGCAACGCGTTCATCCGCGTGGTCAACCAGG
CCGACGGGCAGGAACTGGCCCGCTACGACCTCAGCGAGGACGCCTCCACGGAGACGGCGATGATCTTCGGCGAGCTGTAC
CGGTACGGGGGCGAGTGGAAGTTCCGGGCGGTGGGACAGGGGTACGCGTCCGGCCTCAGGGGCATCGCTCTAGACTTCGG
GGTCAGCGTCTCCTAA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTQVLVGLGWDARSTTGAPFDLDASALLCTSGRVMGDEWFVFYNNLKSPDGSVEHTGDNLT
GEGDGDDESLLVDLAQVPAHCDKIVFPVSIHEADVRGQTFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGELY
RYGGEWKFRAVGQGYASGLRGIALDFGVSVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 68
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 68
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-58 68
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-60 67
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-52 61
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-54 61
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-52 61
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-52 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-26 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-26 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNR_4530 YP_007747856.1 Tellurium resistance protein TerD BAC0389 Protein 4e-58 67
XNR_4530 YP_007747856.1 Tellurium resistance protein TerD BAC0390 Protein 9e-57 63
XNR_4530 YP_007747856.1 Tellurium resistance protein TerD BAC0392 Protein 9e-26 42