Gene Information

Name : ECBG_00143 (ECBG_00143)
Accession : YP_007752017.1
Strain : Enterococcus casseliflavus EC20
Genome accession: NC_020995
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein yycF
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 830484 - 831188 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence :
TTGAAAAAGATCCTAGTCGTGGACGATGAGAAACCAATTTCTGATATCGTCAAATTTAATTTAACCAAAGAAGGATATGA
AGTATATACCGCCTATGATGGAGAAGAGGCATTAGAAAAAGTAGCCGAGGTCGATCCTGATCTGATTTTGCTTGATTTGA
TGCTGCCAAAAATGGATGGGTTGGAAGTTGCACGGGAAGTGCGCAAAACCCATGACATGCCGATCATCATGGTCACAGCC
AAAGATTCTGAAATCGATAAAGTACTAGGCCTCGAGCTTGGTGCGGACGATTATGTAACCAAACCATTTTCAAACCGGGA
ATTGGTGGCCCGCGTCAAAGCCAATCTGCGTCGCGGCTCGGCAGCTGCGAAGGAAGCAGACGATAACGCCAACAGCGAAT
TAACGATTGGTGATTTAACCATTCATCCTGATGCGTACATGGTCACTAAAAATGGTGCAGCCATCGAATTGACGCACCGA
GAGTTTGAATTGATGCACTACTTGGCAAAACATCTTGGTCAAGTGATGACCCGGGAGCATTTATTGCAAACGGTTTGGGG
TTATGACTACTTTGGTGATGTTCGGACCGTTGACGTGACGGTGCGTCGTTTACGTGAAAAAATCGAAGACAGCCCGAGCC
ATCCAAATTATTTGGTTACTCGTCGCGGAGTGGGCTATTACTTGCGGAACCCAGAACAGGAATAA

Protein sequence :
MKKILVVDDEKPISDIVKFNLTKEGYEVYTAYDGEEALEKVAEVDPDLILLDLMLPKMDGLEVAREVRKTHDMPIIMVTA
KDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRRGSAAAKEADDNANSELTIGDLTIHPDAYMVTKNGAAIELTHR
EFELMHYLAKHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPNYLVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_012469.1.7685629. Protein 3e-62 69
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_013450.8614421.p0 Protein 2e-45 54
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_007793.3914279.p0 Protein 2e-45 54
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_002952.2859905.p0 Protein 3e-45 54
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_007622.3794472.p0 Protein 2e-45 54
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_002745.1124361.p0 Protein 2e-45 54
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_009782.5559369.p0 Protein 2e-45 54
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_002951.3237708.p0 Protein 2e-45 54
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_003923.1003749.p0 Protein 2e-45 54
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_002758.1121668.p0 Protein 2e-45 54
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_009641.5332272.p0 Protein 2e-45 54
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF HE999704.1.gene2815. Protein 6e-40 53
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF AE016830.1.gene1681. Protein 2e-40 48
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_012469.1.7686381. Protein 2e-35 48
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF AE000516.2.gene3505. Protein 1e-28 47
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_002695.1.915041.p Protein 3e-32 47
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF CP000034.1.gene3834. Protein 3e-32 47
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF CP001138.1.gene4273. Protein 2e-32 47
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF CP004022.1.gene3215. Protein 8e-32 47
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF AF155139.2.orf0.gene Protein 2e-31 46
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF BAC0533 Protein 3e-32 46
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF CP000647.1.gene4257. Protein 3e-32 46
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF FJ349556.1.orf0.gene Protein 8e-32 45
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_013450.8614146.p0 Protein 1e-30 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_002951.3238224.p0 Protein 1e-30 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_007793.3914065.p0 Protein 1e-30 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_002758.1121390.p0 Protein 1e-30 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_010079.5776364.p0 Protein 1e-30 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_002952.2859858.p0 Protein 1e-30 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_007622.3794948.p0 Protein 1e-30 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_003923.1003417.p0 Protein 1e-30 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF CP001138.1.gene2239. Protein 3e-23 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF BAC0596 Protein 3e-23 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF AE015929.1.gene1106. Protein 3e-24 43
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_010410.6002989.p0 Protein 3e-22 43
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_010400.5986590.p0 Protein 1e-21 43
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_011595.7057856.p0 Protein 3e-22 43
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF CP000034.1.gene2186. Protein 1e-23 43
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_002695.1.916589.p Protein 1e-23 43
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF BAC0039 Protein 1e-23 43
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_014475.1.orf0.gen Protein 3e-32 42
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF NC_005054.2598277.p0 Protein 3e-32 42
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF AM180355.1.gene1830. Protein 1e-32 42
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF AF162694.1.orf4.gene Protein 6e-28 42
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF DQ212986.1.gene4.p01 Protein 1e-32 42
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF CP004022.1.gene1676. Protein 9e-20 42
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF CP001918.1.gene3444. Protein 8e-22 42
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF HE999704.1.gene1528. Protein 4e-25 41
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF CP000647.1.gene2531. Protein 6e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF VFG1389 Protein 6e-26 44
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF VFG1386 Protein 2e-29 43
ECBG_00143 YP_007752017.1 transcriptional regulatory protein yycF VFG1702 Protein 3e-27 41