Gene Information

Name : CC1_16950 (CC1_16950)
Accession : YP_007769858.1
Strain : Coprococcus catus GD/7
Genome accession: NC_021009
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1758386 - 1759066 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGGAAAGTTTGAAGATTTTAGTGGTAGATGATGAGAGCAGAATGAGGAAGCTTGTGAGGGACTTTTTGACGAAGAAAGG
ATTTACTGTTATTGAGGCCGGAGACGGCGAGGAAGCAGTGGACAAGTTCTTTGAAGTGAAGGATATTGCACTGATCATTC
TGGATGTGATGATGCCGAAGATGGATGGCTGGCAGGTATGCCGTGAGATCAGACAGTACTCCAAGGTCCCGATTATTATG
CTGACGGCTAAGAGTGATGAGAAGGATGAGCTGCAGGGCTTTGATCTCGGTGTGGATGAGTATATTACGAAACCCTTCAG
TCCGAAGATCCTTGTGGCGAGAGTCGAGGCCATCCTTCGGAGAAGCAATGTGCTGGCGGCAGATGATACCATGGAAGCCG
GCGGTATTGAACTGAATAAGGCTGCCCATGAAGTACTGATTGATGGCAAGTCTGTAGAACTCAGCTATAAGGAATTTGAA
CTGTTGGCTTATTTCATGTCCAATCAGGGGGTGGCCTTGTCCAGAGAGCGTATTCTGAACAATGTATGGAATTATGATTA
TTTTGGTGATGCCAGAACCATTGATACCCATGTGAAGAAGCTCAGAAGCAAGCTGGGAGCTAAGGGCGAGTATATTAAAA
CCATCTGGGGTATGGGCTATAAATTCGAAGTCAATCAGTAA

Protein sequence :
MESLKILVVDDESRMRKLVRDFLTKKGFTVIEAGDGEEAVDKFFEVKDIALIILDVMMPKMDGWQVCREIRQYSKVPIIM
LTAKSDEKDELQGFDLGVDEYITKPFSPKILVARVEAILRRSNVLAADDTMEAGGIELNKAAHEVLIDGKSVELSYKEFE
LLAYFMSNQGVALSRERILNNVWNYDYFGDARTIDTHVKKLRSKLGAKGEYIKTIWGMGYKFEVNQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-41 43
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-40 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-42 48
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-42 48
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 9e-43 48
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-42 48
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-42 48
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-42 48
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-42 48
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 1e-42 48
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-42 48
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-42 48
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF310956.2.orf0.gene Protein 8e-42 43
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene2255. Protein 6e-41 43
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain U35369.1.gene1.p01 Protein 6e-41 43
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 2e-38 43
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1202. Protein 1e-37 42
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 4e-40 42
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 6e-38 41
CC1_16950 YP_007769858.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 8e-38 41