Gene Information

Name : CK1_38270 (CK1_38270)
Accession : YP_007785178.1
Strain : Ruminococcus sp. SR1/5
Genome accession: NC_021014
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3366487 - 3367227 bp
Length : 741 bp
Strand : -
Note : -

DNA sequence :
ATGGAACAAAAAAGACCAGACGATTATGAAGTGCCAACGGCAAAAAACGAACAGAGAGGATATAGAATGATCTACTGTGT
GGAAGATGAGAGAAATATCAGAGAGCTTCTTGTCTATACCCTGGAGACAACAGGCTTTGAGGCAGAAGGTTTTGAAACCG
GGGCAGAACTTGACACAGCCATGAAAAAAAATATGCCGGAACTGATCCTGCTGGATATCATGCTCCCGGGTGAAGATGGG
TATAATATTTTGAAACGACTGAAAAGTGATACCAGGACCCGGGATATCCCGGTGATCATGGTCACAGCCAAAGAAGCGGA
GTTTGACAAGGTAAAAGGTCTGGAGGGCGGCGCAGATGATTACATCACCAAGCCCTTCGGGATGATGGAATTTGTAGCCA
GGGTTAAAGCGGTCCTTCGGCGCTGCGCAAGGCAGAGCGAAGAGAGGGAGCTGCACTGTAAGGGTCTTCGTGTCAATGTG
TCCCGTCACGAAGTCAGCTATCAGGGTGAGGTGAAGGAGCTGACCAGAAAGGAATTCGAGCTTCTGGAATATCTTATGGA
GAACAAAGGACTGGTCATGTCCAGAAACCAGATCCTGTGCCATGTGTGGGGCTATGATTTTGACGGAGAAACAAGGACTG
TAGATGTTCATGTACGGACTCTCCGACAAAAGCTGGGGGAAGCCGGAAATCTGATCGAGACAGTGCGTGGCGTGGGATAC
CGGATCGGAGATCATGTATGA

Protein sequence :
MEQKRPDDYEVPTAKNEQRGYRMIYCVEDERNIRELLVYTLETTGFEAEGFETGAELDTAMKKNMPELILLDIMLPGEDG
YNILKRLKSDTRTRDIPVIMVTAKEAEFDKVKGLEGGADDYITKPFGMMEFVARVKAVLRRCARQSEERELHCKGLRVNV
SRHEVSYQGEVKELTRKEFELLEYLMENKGLVMSRNQILCHVWGYDFDGETRTVDVHVRTLRQKLGEAGNLIETVRGVGY
RIGDHV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-30 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-28 45
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 6e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 3e-26 45
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 6e-34 45
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 2e-32 45
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0596 Protein 2e-25 45
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001138.1.gene2239. Protein 2e-25 45
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000647.1.gene2531. Protein 6e-27 45
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001918.1.gene3444. Protein 1e-26 45
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 7e-34 45
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 5e-36 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 6e-36 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 6e-36 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 6e-36 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 6e-36 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 6e-36 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 6e-36 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 4e-36 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 6e-36 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 6e-36 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 3e-32 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 3e-32 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 3e-32 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 3e-32 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 3e-32 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 3e-32 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 3e-32 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 3e-32 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 5e-25 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 9e-28 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000034.1.gene2186. Protein 2e-26 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002695.1.916589.p Protein 2e-26 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0039 Protein 2e-26 44
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 6e-29 43
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 4e-30 42
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0111 Protein 7e-32 42
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 3e-26 41
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 3e-26 41
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 2e-23 41
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 4e-27 41
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF130997.1.orf0.gene Protein 2e-21 41
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 2e-28 41
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain EU250284.1.orf4.gene Protein 5e-25 41
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP004022.1.gene1676. Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 3e-30 45
CK1_38270 YP_007785178.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 1e-29 43