Gene Information

Name : RTO_02800 (RTO_02800)
Accession : YP_007785567.1
Strain : [Ruminococcus] torques L2-14
Genome accession: NC_021015
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 272473 - 273147 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGAGATTACTGATTGTAGAAGACGAGAATGATTTAAGAAACATTGTCAAAAAAAGGCTTGTCAAGGAACATTACAGTGT
AGATGCCTGTGGGGATGGTCTGGAAGCGATGGCTTATATCGATATGACTTCCTACGATGGTATTATTCTTGATATCATGT
TGCCGGGAAAGGATGGATATGAAATCTTAAGAGAATTAAGGCAACGAGAAGATGATACACCGGTTCTGTTACTGACAGCA
AAAGACAGCATTGAAGACCGTGTCAGAGGACTGGATCTTGGTGCCGATGATTACCTGATCAAACCATTTGCATTTGAAGA
ACTGCTTGCAAGAATCCGTGTCATGATGCGTAGAAAGCCACAATTTACATCCAATCAACTAAAAATAGCAGATCTTATTC
TGGATCGTGACACAAGAAAGGTTACAAGAGCCGGAAATGAAATTGATCTTTCTGCAAAAGAATTTATGGTTCTGGAATGT
CTTATGCGCAATAAAAATATCGTAATGACAAGACAGCAGATTGAACAGAATGCGTGGGACTTTGATTTTGAAGGTGGTTC
CAATGTGATTGACGTATACATTCGCTATTTGCGAAAAAAAATCGATGCACAATACGAACAAAAACTTATCCACACTGTTC
GCGGTGTCGGATATGTAATGAGGGAAAACGAATGA

Protein sequence :
MRLLIVEDENDLRNIVKKRLVKEHYSVDACGDGLEAMAYIDMTSYDGIILDIMLPGKDGYEILRELRQREDDTPVLLLTA
KDSIEDRVRGLDLGADDYLIKPFAFEELLARIRVMMRRKPQFTSNQLKIADLILDRDTRKVTRAGNEIDLSAKEFMVLEC
LMRNKNIVMTRQQIEQNAWDFDFEGGSNVIDVYIRYLRKKIDAQYEQKLIHTVRGVGYVMRENE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-41 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-40 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 5e-48 50
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0347 Protein 3e-44 48
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 9e-48 48
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0111 Protein 8e-50 48
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 2e-40 47
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 2e-40 47
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 2e-40 47
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 2e-40 47
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 2e-40 47
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 2e-40 47
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 2e-40 47
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 2e-40 47
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0638 Protein 7e-44 47
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 5e-46 47
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 4e-46 45
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 4e-35 45
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 1e-37 44
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0288 Protein 5e-33 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 3e-48 48
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 7e-42 44
RTO_02800 YP_007785567.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 3e-43 41