Gene Information

Name : CCU_10730 (CCU_10730)
Accession : YP_007796105.1
Strain : Coprococcus sp. ART55/1
Genome accession: NC_021018
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1078536 - 1079204 bp
Length : 669 bp
Strand : +
Note : -

DNA sequence :
ATGCGTGTACTTGTAGTTGAGGATGAGAAGGATCTGAACAGCATAATATGCAGTAAGCTGGTCAAAGAGGGCTATAATGT
GGATGCCTGTTATGACGGACAGGCGGCACTTGATTATATGGAAGCGGAGAATTACGACGGGGCGATCATGGATATAATGA
TCCCGAACAAGGACGGAATAACAGTCCTGCGCGAGATGAGAAATGCGGGGATACAGGTTCCTGTGCTTTTCCTCACGGCC
AAGACGGAGACACAGGATATAGTCAGGGGACTGGATGCCGGAGCCAGCGATTATATGACAAAGCCATTTGAGTTCTCGGA
GCTTATGGCAAGACTCAGGGTCATGCTGAGAACCCAGAATCCGGTAAATGAGAATGTGATAACCTGTGGTTCACTGGTGG
TCGACATGAACAACAGACAGGCGATCAGGGATGGAAAGGTAATTGATCTCACGGTCAGGGAGTATGCTATCCTTGAGTAC
CTAGCCAGAAACAGAAATGTGGTAGTAACTAGGGAACAGATACGGGTGAACATCTGGAACATAGATGACGATGTCAATTC
AAATGTGATAGATGTGTATATCCGTTATCTGAGAAGGAAGATAGACGATAATTATGAGGAGAAGCTGATCCATACTATAA
GAGGTGTCGGCTATAAACTGGAATGTTAA

Protein sequence :
MRVLVVEDEKDLNSIICSKLVKEGYNVDACYDGQAALDYMEAENYDGAIMDIMIPNKDGITVLREMRNAGIQVPVLFLTA
KTETQDIVRGLDAGASDYMTKPFEFSELMARLRVMLRTQNPVNENVITCGSLVVDMNNRQAIRDGKVIDLTVREYAILEY
LARNRNVVVTREQIRVNIWNIDDDVNSNVIDVYIRYLRRKIDDNYEEKLIHTIRGVGYKLEC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0638 Protein 3e-33 46
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 5e-36 45
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 2e-37 45
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 2e-36 44
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 1e-29 43
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 1e-29 43
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 1e-29 43
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 1e-29 43
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 1e-29 43
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 1e-29 43
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 1e-29 43
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 1e-29 43
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 6e-25 43
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 2e-34 42
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 2e-26 42
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002516.2.879194.p Protein 2e-29 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CCU_10730 YP_007796105.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 1e-31 43