Gene Information

Name : GPA_11370 (GPA_11370)
Accession : YP_007802221.1
Strain : Gordonibacter pamelaeae 7-10-1-bT
Genome accession: NC_021021
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1121115 - 1121825 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGAGCAACGAGACGCGACGTATACTGCTTGTTGAAGACGAGAAGGCCATCCGTGACGCGGTGACGGCCTATCTCGAGCG
CGAGAACTACTGGGTGACGGCGGTCGGAGACGGCCAGGAGGCCCTTGAGGAGTTCTCGAAGCACCACTTCGACCTGGTGA
TCCTGGATCTCATGCTGCCCCGCGTGCCGGGCGAGCGCGTCTGCCGCGCCATCCGCGACAACTCCGACGTGCCCATCATC
ATGCTCACCGCCAAGGGCGAGGTGGAGGATCGCATCATCGGTCTGGAGCTGGGCGCCGACGACTACCTGGTGAAGCCCTT
CAGCCCCCGCGAGCTCGTGGCCCGCGCCCGTGCCCTGCTGCGCCGCGTGCACGCCGACAGCGAGCCGCAGCGCGAGGTGC
TGGAGTTCGGCGAGCTCACCATCGACGTGTCGGGCCACAAGGTGCTCGTCAACGGCGAGGAGATCGACCTCACGGCCAGC
GAGTTCAAGCTGCTCACCACGCTGTCGCGCTACCCTGGCCGCGTGTACTCGCGCATGGAGCTGGTGGAGAAGGTGCTCGG
CTACGACTTCGAAGGCTACGAGCGCACCATCGACAGCCACGTGAAGAACCTGCGCGCGAAGATCGGCGACAACCCGCGCA
GCCCGAAGTGGCTGCACACCGTGCACGGCGTGGGCTACCGCTTCGAAGACCCGACCAAAGTCCAGCAGTAA

Protein sequence :
MSNETRRILLVEDEKAIRDAVTAYLERENYWVTAVGDGQEALEEFSKHHFDLVILDLMLPRVPGERVCRAIRDNSDVPII
MLTAKGEVEDRIIGLELGADDYLVKPFSPRELVARARALLRRVHADSEPQREVLEFGELTIDVSGHKVLVNGEEIDLTAS
EFKLLTTLSRYPGRVYSRMELVEKVLGYDFEGYERTIDSHVKNLRAKIGDNPRSPKWLHTVHGVGYRFEDPTKVQQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-33 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-33 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 6e-40 46
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 8e-36 45
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001138.1.gene2239. Protein 8e-32 44
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0596 Protein 8e-32 44
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010400.5986590.p0 Protein 4e-38 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_011595.7057856.p0 Protein 4e-38 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010410.6002989.p0 Protein 4e-38 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000675.2.gene1535. Protein 3e-38 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-34 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 3e-34 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 3e-34 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 3e-34 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 3e-34 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 3e-34 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 3e-34 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 3e-34 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 2e-34 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 3e-34 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0039 Protein 2e-32 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002695.1.916589.p Protein 1e-32 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000034.1.gene2186. Protein 2e-32 43
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 2e-30 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 2e-30 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 2e-30 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 2e-30 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 2e-30 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 2e-30 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 2e-30 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 2e-30 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 4e-37 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 2e-32 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF130997.1.orf0.gene Protein 2e-27 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 1e-33 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain EU250284.1.orf4.gene Protein 1e-27 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 2e-28 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 3e-25 41
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0111 Protein 4e-24 41
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000647.1.gene2531. Protein 1e-30 41
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 8e-29 41
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 8e-29 41
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AM180355.1.gene1830. Protein 6e-28 41
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF162694.1.orf4.gene Protein 7e-27 41
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 2e-33 41
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_008702.1.4607594. Protein 2e-35 41
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001918.1.gene5135. Protein 1e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1702 Protein 1e-33 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1563 Protein 2e-33 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 3e-26 42
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 1e-23 41
GPA_11370 YP_007802221.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 5e-31 41