Gene Information

Name : CK5_34590 (CK5_34590)
Accession : YP_007806623.1
Strain : [Ruminococcus] obeum A2-162
Genome accession: NC_021022
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3540816 - 3541484 bp
Length : 669 bp
Strand : +
Note : -

DNA sequence :
ATGATCTATTGCGTAGAAGATGAAAAAAATATCAGGGAACTTCTGATCTATACTCTGGAAACGACCGGATTTTCTGCGAA
AGGAATGGCGAATGCCAAAGAACTCCGCATTGCATTAAAAGAAGAACTTCCGGATCTGATTCTTCTGGATATCATGCTTC
CGGGGGAAGACGGATACAGCATACTGGAAAGTCTGAAATTATCAAGAGATACCAGAGGAATCCCGGTGATCATGGTCACA
GCGAAGGAAGCCGAGTATGACAAGGTAAAAGGTCTGGAGGCCGGCGCAGATGACTACATCACGAAGCCTTTCGGGATGAT
GGAGTTTGTGGCAAGGGTAAAAGCGGTTCTTCGCCGCTGTTCCAAACAGGAAGATGACAAAGAACTGAGAACTGGTGATC
TGAGTCTGTCTGTAGGCAGGCATAAGGTTCGCTGGAAGGATACGAGTGTTGAACTGACACGTAAAGAATTTGAACTGCTT
CAGTACCTGATGGAAAATAAGGGACTGGTCATGAGTAGAAATCAGATTCTCTGTCATGTATGGGGATATGATTTTGATGG
TGAGACAAGAACAGTTGATGTCCATGTCCGTACACTACGCCAGAAGCTTGGCGAAGCAGGAAATCTGATAGAAACTGTAC
GGGGAGTCGGTTACCGGATCGGAGTATAA

Protein sequence :
MIYCVEDEKNIRELLIYTLETTGFSAKGMANAKELRIALKEELPDLILLDIMLPGEDGYSILESLKLSRDTRGIPVIMVT
AKEAEYDKVKGLEAGADDYITKPFGMMEFVARVKAVLRRCSKQEDDKELRTGDLSLSVGRHKVRWKDTSVELTRKEFELL
QYLMENKGLVMSRNQILCHVWGYDFDGETRTVDVHVRTLRQKLGEAGNLIETVRGVGYRIGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-25 42
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 2e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-32 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 2e-32 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 2e-32 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 2e-32 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 3e-32 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 2e-32 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 2e-32 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 2e-32 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 2e-32 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 2e-32 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 8e-30 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 7e-29 42
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000647.1.gene2531. Protein 3e-25 42
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 8e-27 42
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 4e-24 41
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-22 41
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001918.1.gene3444. Protein 5e-24 41
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000034.1.gene2186. Protein 2e-24 41
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002695.1.916589.p Protein 2e-24 41
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0039 Protein 2e-24 41
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001918.1.gene5135. Protein 3e-21 41
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 3e-24 41
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 3e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 1e-28 43
CK5_34590 YP_007806623.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 1e-25 42