Gene Information

Name : CK3_01800 (CK3_01800)
Accession : YP_007822541.1
Strain : butyrate-producing bacterium SS3/4
Genome accession: NC_021035
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 190214 - 190879 bp
Length : 666 bp
Strand : +
Note : -

DNA sequence :
ATGGCTCTGATCTATGCGGTAGAAGATGATAAAAATATTCTGGAGATTGAGATGTTCGCGTTAAAGAACAGCGGATATCA
AGTGGAAGGATTTGAATGTGCCCGCGATTTTTATAAAAAGCTGGAAGAGAAGCAGCCGGACCTTGCCCTTTTGGACATTA
TGCTGCCGGATGAGGACGGACTGGAGATCGTTGCAAAGCTCCGCCGTCGTCCGGAGACGAAAAAGCTTCCAATCATCATG
GTGACGGCAAAGAGTACCGAGATCGACAAGGTAAAGGGACTTGATGTCGGAGCTGATGACTACCTGACAAAGCCTTTTGG
TGTCATGGAGCTGATCGCCAGAGTAAAGGCGGTGCTCAGAAGGACGATGGAGGAAGATAAATTCCTGACCCTGGGGGATA
TCTTCCTGGATGATGAGAAACATATGGTATACGTGAAGGATGTTCCGTGCAGCCTGACATTTAAGGAATATGAGCTGTTA
AAGCTCCTGCTCCACAATGCGGGGATCGTAGTGACGCGAGAGATCATTTTAGAGCGCGTCTGGGGAATCGACTTTGAAGG
TGAGTCGAGAACTCTGGACATGCATATCCGGACGCTCAGACAGAAACTCGGTGAAGCGGGTTCCATGATCCGCACTGTGA
GAAATGTGGGGTATATGATCGAATGA

Protein sequence :
MALIYAVEDDKNILEIEMFALKNSGYQVEGFECARDFYKKLEEKQPDLALLDIMLPDEDGLEIVAKLRRRPETKKLPIIM
VTAKSTEIDKVKGLDVGADDYLTKPFGVMELIARVKAVLRRTMEEDKFLTLGDIFLDDEKHMVYVKDVPCSLTFKEYELL
KLLLHNAGIVVTREIILERVWGIDFEGESRTLDMHIRTLRQKLGEAGSMIRTVRNVGYMIE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 3e-32 44
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 8e-30 43
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 8e-30 43
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 8e-30 43
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 8e-30 43
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 8e-30 43
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 8e-30 43
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 8e-30 43
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 8e-30 43
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 6e-25 42
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 3e-35 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 2e-26 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF310956.2.orf0.gene Protein 5e-31 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 1e-34 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 2e-34 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 2e-34 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 6e-32 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-34 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 2e-34 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 2e-34 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 2e-34 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 2e-34 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 1e-34 41
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CK3_01800 YP_007822541.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0473 Protein 2e-30 42