Gene Information

Name : RUM_03870 (RUM_03870)
Accession : YP_007828630.1
Strain : Ruminococcus champanellensis 18P13
Genome accession: NC_021039
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 428321 - 429004 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGATTTACTTGCTGGAGGATGACAACAGCATCCGGGAGCTTGTTACCTATTCGCTGAACAATTCCGGGCTGGAAACCAG
GGGCTTTGAAAAGCCCTCGGATTTCTGGCGGGGCATGGAACAGGAGCAGCCGGATCTGGTACTGCTGGATATTATGCTGC
CGGAGGAGGACGGGCTTTCGATTCTCAAAAAGCTCCGGAGCAATCCCCCCACCCGGAAGCTGCCCATTCTGATGCTGACC
GCCAAGGGCAGCGAATACGACAAGGTCATCGGTCTGGACTGCGGTGCCGACGACTACGTCCCCAAGCCCTTCGGCATGAT
GGAGCTGATCGCCAGGGTCAAGGCGCTGCTGCGCCGGACGGAGCGAAAGGATCCCCAGCCGGAGCATACCATCCGGGGGC
TGTATGTGTGCCCGGCAAAGCACATCGTCACCGTGGACGGGGAACCGGTGTCCCTGACCCTCAAGGAGTTTGAGATGCTG
TGCGTATTCCTGGAAAACCGGAACGTGGTGCTGACCCGGGATCAACTGCTCAACAAGGTGTGGGGCTATGCCTTTGACGG
GGAGAGCCGGACGGTGGACGTACACATCCGTTCCCTGCGGCAGAAGCTGGGAGAGTATGCGGATGTGATCGAAACCGTCC
GGGGCATCGGCTATAAGCTCAGCGAGCCGGAGGGGGCACGATGA

Protein sequence :
MIYLLEDDNSIRELVTYSLNNSGLETRGFEKPSDFWRGMEQEQPDLVLLDIMLPEEDGLSILKKLRSNPPTRKLPILMLT
AKGSEYDKVIGLDCGADDYVPKPFGMMELIARVKALLRRTERKDPQPEHTIRGLYVCPAKHIVTVDGEPVSLTLKEFEML
CVFLENRNVVLTRDQLLNKVWGYAFDGESRTVDVHIRSLRQKLGEYADVIETVRGIGYKLSEPEGAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 5e-29 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 3e-34 48
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 3e-34 48
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 3e-34 48
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 3e-34 48
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 3e-34 48
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 3e-34 48
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 3e-34 48
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 3e-34 48
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 2e-29 47
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 3e-38 44
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 4e-38 44
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 4e-38 44
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 3e-38 44
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 4e-38 44
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 3e-38 44
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 4e-38 44
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 4e-38 44
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 4e-38 44
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 4e-38 44
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain U35369.1.gene1.p01 Protein 2e-29 43
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene2255. Protein 2e-29 43
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 1e-37 42
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 2e-35 42
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 1e-26 42
RUM_03870 YP_007828630.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 2e-30 41