Gene Information

Name : ROI_10070 (ROI_10070)
Accession : YP_007831251.1
Strain : Roseburia intestinalis M50/1
Genome accession: NC_021040
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1007767 - 1008465 bp
Length : 699 bp
Strand : +
Note : -

DNA sequence :
ATGGAAAAGATTAAAATATTAGTTGTGGATGATGAAAGCAGAATGAGAAAATTAGTCCGTGATTTTCTGGTCAGGGAAGA
TTATGAGGTGTTAGAAGCGGGAGATGGAGAAACAGCACTCGATATTTTTTATCAGGAAAAAAATATTGCATTGATCATTT
TAGATGTCATGATGCCAAAGATGAATGGATGGGAGGTCTGCAGGGAAATCAGGGAGACTTCGAAAGTGCCAATCATCATG
CTGACGGCGAAGGGCGATGAGGAGGACGAGCTGACAGGGTTCGAACTTGGAGTTGATGAGTATATCTCAAAACCGTTTTC
TCCGAAGATCTTAGTTGCGCGTGTCGGTGCAATCTTAAGAAGAATCGGAAAGGCACCGGAGGAGGGAAAACTTCTTTCCA
TCGGCGGCATCGTGATCGATCAGACTGCACATACAGTGACGGTGGATGGCAGACAGATCGAATTAAGCTTCAAGGAATTT
GAACTGCTTACCTATTTTATGGAAAACGAAGGCATTGCACTTTCCAGGGAAAAGATTCTTAATCATGTCTGGAACTATGA
TTATTTCGGGGACGCCAGAACGATCGATACACATGTCAAAAAACTGCGTGCCAAGATCGGTGAAAAAGGAGATTACATAA
AAACCATCTGGGGCATGGGTTACAAATTCGAAGCAGAAGAAAATGGCAGTGATAAGTAA

Protein sequence :
MEKIKILVVDDESRMRKLVRDFLVREDYEVLEAGDGETALDIFYQEKNIALIILDVMMPKMNGWEVCREIRETSKVPIIM
LTAKGDEEDELTGFELGVDEYISKPFSPKILVARVGAILRRIGKAPEEGKLLSIGGIVIDQTAHTVTVDGRQIELSFKEF
ELLTYFMENEGIALSREKILNHVWNYDYFGDARTIDTHVKKLRAKIGEKGDYIKTIWGMGYKFEAEENGSDK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-40 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 6e-40 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-40 46
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 3e-40 46
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 3e-40 46
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 2e-40 46
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 3e-40 46
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 3e-40 46
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 3e-40 46
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 3e-40 46
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 2e-40 46
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 3e-40 46
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 3e-39 43
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 5e-33 43
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF310956.2.orf0.gene Protein 7e-41 42
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain U35369.1.gene1.p01 Protein 3e-40 42
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene2255. Protein 3e-40 42
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 3e-40 42
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 1e-39 42
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 1e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROI_10070 YP_007831251.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 1e-32 42