Gene Information

Name : MHY_28490 (MHY_28490)
Accession : YP_007835959.1
Strain : Megamonas hypermegale ART12/1
Genome accession: NC_021041
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2147900 - 2148595 bp
Length : 696 bp
Strand : +
Note : -

DNA sequence :
ATGCAAAAAATTTACTGTGTTGAAGATGACGAAAGCGTTCGCGAACTTGTCATCTATGCATTACAATCTTCTGGATTTGA
AGCTCAAGGCTTTGTCAATGCTGAAGAATTTTTTCCTGTACTAAAAAATAATGTGCCTGATTTAATTCTTTTAGACATTA
TGCTTCCTGGCATTGATGGCATTGAAATTCTCAAAGAAGTTCGTAAAAATCCTAAAACACAACATACTCCTATCATCATG
CTCACAGCTCGTGGTAGTGAATATGATAAAATAACTGGTCTTGATAATGGTGCTGATGATTATGTAACTAAACCATTCGG
TGTAATGGAATTAATCGCACGCATAAAAGCAGTTTTACGTCGCAGTGCAAAAATCAATGTAGCACAAGATAAAGCTACTA
ATGATTTATCTGCTAGTAATGGTCTTCTTGTATTAAATCATGATTTCCATAAAGTCTATGTAAATAATGAAGAAGTCATT
TTGACATTAAAAGAATTTGAACTTTTATATTATCTATTAAAAAATAAAAATATCGTTATTTCCCGCGATAAAATTATGGA
TGAAGTATGGGATTATAATTATGCAGCTGAAACTCGTACTGTCGATGTGCATATAAAAACGCTTCGCCATAAATTAGGAG
TAGCCAGCAAATTAATCGAAACTATCCGTGGAGTCGGTTATAAAATCATTGATTAA

Protein sequence :
MQKIYCVEDDESVRELVIYALQSSGFEAQGFVNAEEFFPVLKNNVPDLILLDIMLPGIDGIEILKEVRKNPKTQHTPIIM
LTARGSEYDKITGLDNGADDYVTKPFGVMELIARIKAVLRRSAKINVAQDKATNDLSASNGLLVLNHDFHKVYVNNEEVI
LTLKEFELLYYLLKNKNIVISRDKIMDEVWDYNYAAETRTVDVHIKTLRHKLGVASKLIETIRGVGYKIID

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 3e-25 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 9e-24 46
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 8e-36 43
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 8e-36 43
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 1e-28 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 1e-28 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 1e-28 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 1e-28 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 1e-28 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 1e-28 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 1e-28 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 1e-28 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 6e-32 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-35 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-35 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-35 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-35 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-35 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-35 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-35 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-35 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 5e-35 42
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 3e-31 41
MHY_28490 YP_007835959.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 3e-23 41