Gene Information

Name : FP2_12550 (FP2_12550)
Accession : YP_007837063.1
Strain : Faecalibacterium prausnitzii L2/6
Genome accession: NC_021042
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1239248 - 1239946 bp
Length : 699 bp
Strand : -
Note : -

DNA sequence :
ATGGCAAACGAAAAGATACTCGTTGTGGACGACGATACCAACATCTGCGAGCTGCTGCGGCTCTACCTGACCAAGGAGGG
CTATCAGGTCACGACGGCCAACGACGGCGAAGAGGGCCTTGAAAAGTTCAACCAGCTCAAGCCCGACATGGTGCTGCTGG
ACGTCATGATGCCCAGGATGGACGGCCTCGAGGTCTGCCGCCGCATCCGCAAGCTGGGCAACACCCCGGTCATGATGCTG
ACGGCCAAGGGCGAGACCTTCGATAAGGTGCTGGGCCTCGAGCTGGGCGCAGACGACTACATGGTCAAGCCCTTCGACAC
CAAAGAGGTCGTGGCCCGCATCAAGGCGGTGCTGCGCCGCTGCACCGTCACCACGTCCCAGACCGAGAGCTCCGAGGGCG
TCATCGAGTTCGACAACCTCCGTCTCGACATGAACAGCTACGAGCTGCGGGTCAAGGGCAAGGTGGTGGAAGCTCCCCCG
AAGGAGCTGGAACTGCTGAACTGCCTGGCTTCTCACCCCAACCGGGTCTACACCCGCGACCAGCTGCTGGACGAGGTGTG
GGGCTTCGAATACTATGGCGACAGCCGCACCATCGACGTCCATGTCAAGCGCCTGCGCGAGAAGCTGGCCGGTGCTTCCG
ATAAATGGGAGCTGAAGACCGTCTGGGGCGTGGGCTATAAATTCGAGGTGCGTCAGTAA

Protein sequence :
MANEKILVVDDDTNICELLRLYLTKEGYQVTTANDGEEGLEKFNQLKPDMVLLDVMMPRMDGLEVCRRIRKLGNTPVMML
TAKGETFDKVLGLELGADDYMVKPFDTKEVVARIKAVLRRCTVTTSQTESSEGVIEFDNLRLDMNSYELRVKGKVVEAPP
KELELLNCLASHPNRVYTRDQLLDEVWGFEYYGDSRTIDVHVKRLREKLAGASDKWELKTVWGVGYKFEVRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 3e-49 48
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 3e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 4e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 4e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 4e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 4e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 4e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 4e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 4e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 3e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 4e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 7e-52 47
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 2e-46 45
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 4e-45 44
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF162694.1.orf4.gene Protein 9e-36 43
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain EU250284.1.orf4.gene Protein 1e-37 43
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP004022.1.gene3215. Protein 4e-35 43
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 2e-36 42
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001485.1.gene721.p Protein 1e-31 42
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0533 Protein 5e-32 42
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000647.1.gene4257. Protein 5e-32 42
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001138.1.gene4273. Protein 8e-32 42
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001918.1.gene5135. Protein 2e-27 42
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 2e-40 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 2e-40 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 2e-40 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 2e-40 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 2e-40 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 2e-40 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 2e-40 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 2e-40 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 9e-46 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 8e-43 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002695.1.915041.p Protein 8e-32 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000034.1.gene3834. Protein 8e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 7e-33 42
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 3e-39 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1563 Protein 7e-38 41
FP2_12550 YP_007837063.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1702 Protein 7e-38 41