Gene Information

Name : ENC_18470 (ENC_18470)
Accession : YP_007845622.1
Strain : Enterobacter cloacae NCTC 9394
Genome accession: NC_021046
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1888513 - 1889238 bp
Length : 726 bp
Strand : -
Note : -

DNA sequence :
ATGATTGAAGGCTTACCCATGAAGCAGATCCTGCTGGTAGAAGACGACCACGATATCGCGGCACTCCTGCGTCTTAATCT
GGAAGATGAAGGCTACGCCATTACCCACGAGCCCGACGGGGGCAACGCCTTACAGCGTCTTGAAACACAGCCGTGGGACG
CGGTGATCCTCGATCTGATGCTGCCGAATGTCGATGGTCTGGAGATTTGCCGCCGTATCCGCCAGATGACCCGCTACCTG
CCCATTATCATCATTAGCGCCCGCAGCAGTGAAACTGACCGTATTACCGGCCTGGAAACCGGGGCGGATGATTATCTGGC
AAAACCTTTCTCGGTGCAGGAGCTGATTGCCCGCATTAAGGCGCTGTTTCGCCGTCAGCAGGCGATGGGCCAGGCGCAGA
CGGACGGCATTATTCAGGCGCACGGACTGACTATCGATCCGCTGGCGCGCACCGTGCGCCTTAACGGTCAACACGTCGAT
CTCACCCCGCGCGAATTTGAACTGCTCTATTTCTTTGCCCGCCATCCCGGAGAGGTCTTTTCGCGGCTGGCACTGCTGGA
GCAGGTATGGGGGTATCAGCACGAAGGCTACGAACACACCGTCAATACCCACATTAACCGCCTGCGCATTAAAATAGAGA
AAGATGCCGCCGAGCCGGAGATCGTTCGCACCGTCTGGGGCAAAGGCTACAAATTTGCGGAGCAGAATCATGATGCGTCG
CTTTAG

Protein sequence :
MIEGLPMKQILLVEDDHDIAALLRLNLEDEGYAITHEPDGGNALQRLETQPWDAVILDLMLPNVDGLEICRRIRQMTRYL
PIIIISARSSETDRITGLETGADDYLAKPFSVQELIARIKALFRRQQAMGQAQTDGIIQAHGLTIDPLARTVRLNGQHVD
LTPREFELLYFFARHPGEVFSRLALLEQVWGYQHEGYEHTVNTHINRLRIKIEKDAAEPEIVRTVWGKGYKFAEQNHDAS
L

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-81 73
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-81 73

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 3e-43 45
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 1e-41 44
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 1e-41 44
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 1e-41 44
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 1e-41 44
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 1e-41 44
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 1e-41 44
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 1e-41 44
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 1e-41 44
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 3e-37 43
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 2e-43 42
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 9e-38 42
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 5e-42 41
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 1e-42 41
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 6e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1563 Protein 1e-81 73
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1702 Protein 9e-82 73
ENC_18470 YP_007845622.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 7e-35 41