Gene Information

Name : CLS_13420 (CLS_13420)
Accession : YP_007848980.1
Strain : Clostridium saccharolyticum K10
Genome accession: NC_021047
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1294542 - 1295213 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGAGAATTTTATTTGCAGAGGATGAGCCGGCCCTCAGGGAAGTGACGGTAAAGCGGCTTAAGGCGGAAGGGTTTGGCGT
AGACGGATGCAGGGACGGCAGGGAGGTTCTCGATTATCTGGACAGCACAGACTACGACGTGGTGATTCTGGATATTATGA
TGCCTGGAATCGACGGGCTGACCGTGCTTCGAACACTCAGAAGCCGGGGAAATACGGTGCCTGTCATGCTTCTGACAGCC
AGGGATGCCGTCGCTGACCGGGTGGGAGGGCTGGACGCCGGGGCAGATGACTACCTGACGAAGCCCTTCGAATTTGCGGA
GCTGACTGCCCGCATCCGCGCTCTGCTTAGAAGAAATTCTGACAATAAGACGGATACGGCCTCTGTGGCAGATCTGACAG
TGGAGTTTTCCACCAGGAAAGTGACGAGGGGAGGGGTGGAGATCAGCCTTTCTTCCCGGGAATTTGCCCTGCTGGAATCC
CTGATCCGCCATAAGGGAGCCATACTCTCACGCACACAGCTGGAAAACCAGGTCTGGGATTTTGGCTTTGAGGGGGGAAG
CAACATTGTGGATGTCTATATCCGTTATCTCAGAAAAAAGATTGACGATCCCTTTGAGAAGAAGCTGATCCACACAGTGC
GGGGAGCCGGCTATACACTGAGGGAGGAGTGA

Protein sequence :
MRILFAEDEPALREVTVKRLKAEGFGVDGCRDGREVLDYLDSTDYDVVILDIMMPGIDGLTVLRTLRSRGNTVPVMLLTA
RDAVADRVGGLDAGADDYLTKPFEFAELTARIRALLRRNSDNKTDTASVADLTVEFSTRKVTRGGVEISLSSREFALLES
LIRHKGAILSRTQLENQVWDFGFEGGSNIVDVYIRYLRKKIDDPFEKKLIHTVRGAGYTLREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-43 49
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-42 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 1e-50 52
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 8e-50 50
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 8e-49 50
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0638 Protein 9e-45 50
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0111 Protein 5e-49 48
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0347 Protein 9e-44 47
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 2e-47 46
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 6e-39 44
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 6e-39 44
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 6e-39 44
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 6e-39 44
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 6e-39 44
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 6e-39 44
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 6e-39 44
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 6e-39 44
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 8e-34 42
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 8e-34 42
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 5e-44 49
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 8e-49 48
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 7e-46 47
CLS_13420 YP_007848980.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 5e-43 43