Gene Information

Name : terD (F750_2235)
Accession : YP_007859213.1
Strain : Streptomyces sp. PAMC26508
Genome accession: NC_021055
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2308950 - 2309525 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGGCGTCACGCTCGCCAAGGGAGGCAATGTCTCCCTCTCCAAGGCCGCACCCAATCTCACGCAGGTGCTGGTCGGGCT
CGGCTGGGACGCACGATCCACGACGGGAGCCGACTTCGACCTGGACGCCAGCGCACTGCTGTGCCAGTCGGGCCGGGTCC
TCGGCGACGAGTGGTTCGTGTTCTACAACAACCTCACCAGCCCCGACGGCTCCGTCGAGCACACCGGTGACAACCTCACG
GGGGAGGGCGACGGCGACGACGAGTCCGTCATCGTGAACCTCACGCAGGTGCCGGCGCACTGCGACAAGATCCTTTTCCC
GGTCTCCATCCATGAAGCCGACAATCGTGGGCAGACATTCGGTCAGGTCAGCAATGCCTTCATCCGCGTGGTCAACCAGG
CGGACGGGCAGGAACTGGCACGGTACGACCTCACCGAGGACGCGTCGACGGAGACGGCGATGATCTTCGGCGAGCTCTAC
CGATATGGCGGGGAGTGGAAATTCCGTGCAGTCGGACAGGGGTACGCGTCCGGGCTCCGCGGCATCGCTCTAGACTTCGG
GGTCAACGTTTCGTAA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTQVLVGLGWDARSTTGADFDLDASALLCQSGRVLGDEWFVFYNNLTSPDGSVEHTGDNLT
GEGDGDDESVIVNLTQVPAHCDKILFPVSIHEADNRGQTFGQVSNAFIRVVNQADGQELARYDLTEDASTETAMIFGELY
RYGGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 70
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 70
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-58 69
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-60 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-53 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-53 62
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 9e-54 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-55 61
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_007859213.1 tellurium resistance protein TerD BAC0389 Protein 2e-57 68
terD YP_007859213.1 tellurium resistance protein TerD BAC0390 Protein 5e-58 64
terD YP_007859213.1 tellurium resistance protein TerD BAC0392 Protein 2e-25 43