Gene Information

Name : F750_6703 (F750_6703)
Accession : YP_007863612.1
Strain : Streptomyces sp. PAMC26508
Genome accession: NC_021055
Putative virulence/resistance : Virulence
Product : ABC-type Fe3+-siderophore transport system ATPase component
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 7145632 - 7146471 bp
Length : 840 bp
Strand : +
Note : -

DNA sequence :
GTGGGCGCTCAGCACGGCACGACGAAGCATTCCGCGGCCTCGGACGAAGCGCGGCTCGCCGCCAGAGGTGTCACGGTCGG
ATACGGCGGACGGACCGTCATCGACGGGCTCGACGTGACGGTGCCGTCAGGGCTGATCACCACGATCATCGGACCCAACG
GCTGTGGCAAGTCGACCCTGTTGCGCACCCTGACGCGGCTGCTCAAGCCCGCCTCGGGGGCGGTCGTCCTGGACGGCGAG
GACATCGCCGGGCTCAGGACCAGGGACGTGGCGAAGAAGCTCGGCCTCCTGCCGCAGGCCCCGGTCGCGCCGGAGGGCCT
GACGGTGGCCGACCTGGTCGCACGCGGGCGCCACCCGCACCAGAGCTGGCTGAGGCAGTGGTCCTCGGACGACGCATCCG
TCGTGGAGCGGGCCCTGGCCATGACCGGGGTGTCCGAACTGGCCGACCGTCCGGTGGACTCGTTGTCGGGAGGGCAGCGC
CAGCGCGTCTGGATATCGATGACGCTTGCTCAGGGCACCGACCTGCTGCTGCTGGACGAGCCGACCACCTATCTCGACCT
GGCGCACGCGATCGACGTCCTCGACCTGGTGGACGACCTGCACGAGTCCGGCCGCACCGTGGTCATGGTGCTGCACGACC
TCAACCTCGCCACCCGGTACAGCGACAACCTCGTCGTCATGCGGGCGGGTTCGATCCTGGCGCAGGGGCACCCGCGCGAC
GTGATCACGGCCGAGCTGCTGCACGAGGCGTTCGGGCTGAACGCCAAGGTGATCGACGATCCGGTGGGGGACCGGCCGCT
CATCGTGCCCATCGGGCGGACCCATGTGCAGCTCAACTGA

Protein sequence :
MGAQHGTTKHSAASDEARLAARGVTVGYGGRTVIDGLDVTVPSGLITTIIGPNGCGKSTLLRTLTRLLKPASGAVVLDGE
DIAGLRTRDVAKKLGLLPQAPVAPEGLTVADLVARGRHPHQSWLRQWSSDDASVVERALAMTGVSELADRPVDSLSGGQR
QRVWISMTLAQGTDLLLLDEPTTYLDLAHAIDVLDLVDDLHESGRTVVMVLHDLNLATRYSDNLVVMRAGSILAQGHPRD
VITAELLHEAFGLNAKVIDDPVGDRPLIVPIGRTHVQLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
iusE YP_005143742.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 3e-67 62
fagC YP_005682397.1 ATP binding cytoplasmic membrane protein Virulence PiCp 1 Protein 1e-56 49
fagC YP_005684488.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 1e-56 49
fagC YP_005680307.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 1e-56 49
fagC YP_003782430.1 ABC transporter ATP-binding protein Not tested PiCp 1 Protein 1e-56 49
fecE AAL08451.1 ATP-binding protein FecE Virulence SRL Protein 1e-50 48
DIP0585 NP_938961.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 2e-50 48
SP_1035 NP_345510.1 iron-compound ABC transporter ATP-binding protein Not tested PPI-1 Protein 8e-60 47
SPN23F_09560 YP_002510939.1 ferric siderophore ABC transporter ATP-binding protein Virulence PPI-1 Protein 8e-60 47
ciuD YP_003783391.1 iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 2e-49 45
ciuD YP_005685432.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 2e-49 45
ciuD YP_005681255.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 2e-49 45
ciuD YP_005683346.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 2e-49 45
CDCE8392_1767 YP_005134301.1 iron complex transport system ATP-binding protein Virulence Not named Protein 7e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
F750_6703 YP_007863612.1 ABC-type Fe3+-siderophore transport system ATPase component BAC0164 Protein 7e-51 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
F750_6703 YP_007863612.1 ABC-type Fe3+-siderophore transport system ATPase component VFG0925 Protein 3e-59 54
F750_6703 YP_007863612.1 ABC-type Fe3+-siderophore transport system ATPase component VFG1042 Protein 7e-51 48