Gene Information

Name : PALO_04395 (PALO_04395)
Accession : YP_007870853.1
Strain : Propionibacterium avidum 44067
Genome accession: NC_021064
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein, C-terminal domain protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 958584 - 959294 bp
Length : 711 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGAGCGCCACCGGTGAACATGGGCCGATCCTCGTCGTCGATGACGACCCGGCTCTGGCCGAGATGCTCCAGCTCGTCCT
GGTGAAGGAGGGATTCTCGACCGTGTGGGTCGGGCACGGCAACGACGTCATGGACGTCTTTCGTGAGCGCAAACCCGCAC
TCGTCCTCCTCGACCTCATGCTTCCGGGCCGTGACGGCATCCAGATCTGCCAGGACATCCGAGGCGAATCCGGCGTCCCG
ATCATCATGCTGACAGCGCGCTCCGACACCCCTGACGTCGTTCGTGGATTGGGAGCCGGTGCTGATGACTACGTCTCCAA
GCCCTTCCGCTCCGCAGAACTTGTAGCCCGAATCCGAGCCCGGCTTCGCACCCCAGCTGCTCAGCGGGATGAGGGGGGCA
TCATCACCGTCGGGGACCTGACCATCGATCCTGCCGCTCACCTGGTGCAGCGAGGTGGGGAAGAGATCTCCTTGACGCCA
TTGGAGTACTCCCTGCTCGTGACGATGGCCCAACATCCCAACAAGGTGTTCAGCCGTGAGACCCTGCTGCGGGAAGTCTG
GGGCTACACCAGTAATGCGGACACCCGGTTGGTCAATGTCCACATGCAGAGATTGCGCTCCAAGGTGGAACGCAACGCAG
AACGTCCACAGATGATCGTGACGGTGCGCGGAGTCGGATATCGCATCAGGACACCCGGGGAGGAAAGCTGA

Protein sequence :
MSATGEHGPILVVDDDPALAEMLQLVLVKEGFSTVWVGHGNDVMDVFRERKPALVLLDLMLPGRDGIQICQDIRGESGVP
IIMLTARSDTPDVVRGLGAGADDYVSKPFRSAELVARIRARLRTPAAQRDEGGIITVGDLTIDPAAHLVQRGGEEISLTP
LEYSLLVTMAQHPNKVFSRETLLREVWGYTSNADTRLVNVHMQRLRSKVERNAERPQMIVTVRGVGYRIRTPGEES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein AE000516.2.gene3505. Protein 4e-58 57
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein NC_013450.8614146.p0 Protein 3e-40 45
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein NC_002951.3238224.p0 Protein 3e-40 45
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein NC_007793.3914065.p0 Protein 3e-40 45
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein NC_002758.1121390.p0 Protein 3e-40 45
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein NC_010079.5776364.p0 Protein 3e-40 45
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein NC_002952.2859858.p0 Protein 3e-40 45
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein NC_007622.3794948.p0 Protein 3e-40 45
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein NC_003923.1003417.p0 Protein 3e-40 45
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein NC_012469.1.7685629. Protein 1e-42 42
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein BAC0125 Protein 5e-31 42
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein HE999704.1.gene2815. Protein 1e-40 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein VFG1390 Protein 3e-35 42
PALO_04395 YP_007870853.1 transcriptional regulatory protein, C-terminal domain protein VFG1702 Protein 6e-37 41