Gene Information

Name : RORB6_10715 (RORB6_10715)
Accession : YP_007874381.1
Strain : Raoultella ornithinolytica B6
Genome accession: NC_021066
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2345131 - 2345847 bp
Length : 717 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGCAAAGAAAATCCTGTTGGTCGAAGATGACGACGATATTGCCGCGTTGCTGCGTTTAAATCTGCAGGATGAGGGATA
TCAGATTGTGCATGAAGCGGACGGCGCCCAGGCGCTGGTGCAGCTGGAAAAGGGCGGCTGGGATGCGGCGATTCTTGACC
TGATGCTGCCCAACGTCGATGGGCTGGAGATTTGCCGGCGCATTCGCCAGATGACCCGCTATCTGCCGGTGATTATTATC
AGCGCCCGTTCCAGCGAGACGCACCGCGTGCTGGGACTGGAGATGGGGGCGGACGACTACCTGGCCAAACCGTTTTCGGT
TATCGAACTGGTTGCGCGAGTCAAAGCGCTGTTTCGTCGCCAGGAGGCGATGGGGCTTAATTTGCTGATGGATTCCGGGC
GTATCGATTGCCACGGCCTGAGCATCGACCCGCTTTCGCGCGAAATCAGACTGCACGGTGAGCCGGTGGATTTAACGCCG
CGCGAATTTGATCTGCTGTACTACTTTGCCCGCCATCCCGGCGAGGTCTTTTCTCGTCTGGCTCTACTTGACCGCGTCTG
GGGCTACCAGCATGAAGGCTATGAGCATACGGTCAATACGCATATCAACCGTCTGCGCAGTAAAATCGAACGCGACCCGG
CGGAGCCGGAAATCATTCTGACGGTCTGGGGCAAGGGCTATAAATTCGCGCCTGCGCGTCAAGGAGTGGGGCAATGA

Protein sequence :
MAKKILLVEDDDDIAALLRLNLQDEGYQIVHEADGAQALVQLEKGGWDAAILDLMLPNVDGLEICRRIRQMTRYLPVIII
SARSSETHRVLGLEMGADDYLAKPFSVIELVARVKALFRRQEAMGLNLLMDSGRIDCHGLSIDPLSREIRLHGEPVDLTP
REFDLLYYFARHPGEVFSRLALLDRVWGYQHEGYEHTVNTHINRLRSKIERDPAEPEIILTVWGKGYKFAPARQGVGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-87 79
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-86 78

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-44 46
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-30 42
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-40 42
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-38 42
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-40 42
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-35 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-35 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-35 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-35 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-35 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-35 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-35 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-35 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-43 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-43 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-43 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-43 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-43 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-38 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-43 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-43 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-43 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-43 41
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator VFG1563 Protein 4e-87 79
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator VFG1702 Protein 5e-87 78
RORB6_10715 YP_007874381.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-30 43