Gene Information

Name : RORB6_17155 (RORB6_17155)
Accession : YP_007875664.1
Strain : Raoultella ornithinolytica B6
Genome accession: NC_021066
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional regulator SoxS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3766626 - 3766955 bp
Length : 330 bp
Strand : +
Note : COG2207 AraC-type DNA-binding domain-containing proteins

DNA sequence :
ATGTCCCATCAGGATATTATCCAAACGCTTATTGAATGGATTGATGAACATATCGATCAACCACTTAACATTGATGTAGT
CGCCAGAAAATCCGGGTATTCAAAATGGTACCTCCAGCGGATGTTCCGCGCCGTGATGCATCAAACGCTGGGCGATTACA
TCCGCCAGCGCCGGCTGTTGCTGGCCGCAGAGGCGCTTCGGACAACCCAGCGACCGATCTTTGATATTGCGATGGATCTG
GGCTATGTGTCGCAGCAGACGTTCTCACGGGTATTCCGTCGGGAGTTCGATCGTACCCCCAGCGATTATCGTCATCAAAT
TTCCGCCTGA

Protein sequence :
MSHQDIIQTLIEWIDEHIDQPLNIDVVARKSGYSKWYLQRMFRAVMHQTLGDYIRQRRLLLAAEALRTTQRPIFDIAMDL
GYVSQQTFSRVFRREFDRTPSDYRHQISA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-35 91
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-14 47
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-14 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS CP000647.1.gene4499. Protein 3e-38 99
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS CP001918.1.gene327.p Protein 3e-37 93
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene4488. Protein 7e-36 91
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS NC_002695.1.914293.p Protein 5e-35 89
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS BAC0371 Protein 5e-35 89
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS CP000034.1.gene4505. Protein 1e-34 88
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene612.p Protein 9e-19 49
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS NC_010558.1.6276025. Protein 7e-15 47
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS CP000647.1.gene1624. Protein 2e-15 42
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS CP001918.1.gene2033. Protein 1e-15 42
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS BAC0560 Protein 8e-16 41
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS NC_002695.1.917339.p Protein 8e-16 41
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene1637. Protein 1e-15 41
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS CP000034.1.gene1596. Protein 8e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS VFG0585 Protein 6e-36 91
RORB6_17155 YP_007875664.1 DNA-binding transcriptional regulator SoxS VFG1038 Protein 6e-15 47