Gene Information

Name : RORB6_24425 (RORB6_24425)
Accession : YP_007877117.1
Strain : Raoultella ornithinolytica B6
Genome accession: NC_021066
Putative virulence/resistance : Resistance
Product : multiple antibiotic resistance protein marA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5346812 - 5347165 bp
Length : 354 bp
Strand : +
Note : COG2207 AraC-type DNA-binding domain-containing proteins

DNA sequence :
ATGAACACTGGCGCTTTTATACATGATTTACTTGACTGGATTGATAATAACCTTGAAAGCCGCCTCGATATCGACACGGT
CTCCAGGCGGGCAGGCTATTCAAAATGGCATCTTCAGCGGATATTCAAAGAGCATACCGGTCATCCCATTGGCGAATACA
TCCGCGCCCGGAAGCTGCAAAAATCGCTTGAGCGCTTAACCCGCAGCGACGAACCGATCCTCAACGTGGCCATCGCGTTG
GGTTTTGACTCCCAGCAATCCTTCAATCGCAGCTTCAAGCGCCAGTATGGCCAGGCGCCGGGAGTCTGGCGCCGCAGCAT
GGGAATGGCTCCATCGTGCCAGCGTCCAGGCTGA

Protein sequence :
MNTGAFIHDLLDWIDNNLESRLDIDTVSRRAGYSKWHLQRIFKEHTGHPIGEYIRARKLQKSLERLTRSDEPILNVAIAL
GFDSQQSFNRSFKRQYGQAPGVWRRSMGMAPSCQRPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-18 45
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-18 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA CP001918.1.gene2033. Protein 4e-24 54
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA CP000647.1.gene1624. Protein 4e-24 54
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA CP001138.1.gene1637. Protein 5e-24 54
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA BAC0560 Protein 4e-24 51
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA NC_002695.1.917339.p Protein 4e-24 51
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA CP000034.1.gene1596. Protein 3e-24 51
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA NC_010558.1.6276025. Protein 7e-19 45
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA CP001138.1.gene612.p Protein 3e-21 42
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA BAC0371 Protein 4e-23 41
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA NC_002695.1.914293.p Protein 4e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RORB6_24425 YP_007877117.1 multiple antibiotic resistance protein marA VFG1038 Protein 6e-19 45