Gene Information

Name : ureB (AvCA_09890)
Accession : YP_007892008.1
Strain : Azotobacter vinelandii CA
Genome accession: NC_021149
Putative virulence/resistance : Virulence
Product : urease subunit beta
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 940757 - 941062 bp
Length : 306 bp
Strand : -
Note : 'ureases catalyze the hydrolysis of urea into ammonia and carbon dioxide; in Helicobacter pylori and Yersinia enterocolitica the ammonia released plays a key role in bacterial survival by neutralizing acids when colonizing the gastric mucosa; the holoenzy

DNA sequence :
ATGATCCCCGGCGAATACCAGATCCAGGACGGCGAGATCGAACTCAACGCCGGCCGCCGCACGCTGACCCTGAACGTGGC
CAACAGCGGCGACCGGCCGATCCAGGTCGGCTCGCACTACCACTTCTTCGAGACCAACGACGCCCTCGTCTTCGACCGCG
CCCTGGCCCGCGGCATGCGCCTGAACATCCCGGCCGGCACCGCAGTGCGCTTCGAGCCGGGGCAGAGCCGCGAGGTCGAG
CTGGTCGAGCTGGCCGGCCTGCGCCGCGTCTACGGCTTCGCCGGGCGGGTGATGGGCGAACTGTAG

Protein sequence :
MIPGEYQIQDGEIELNAGRRTLTLNVANSGDRPIQVGSHYHFFETNDALVFDRALARGMRLNIPAGTAVRFEPGQSREVE
LVELAGLRRVYGFAGRVMGEL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ureB NP_286679.1 urease subunit beta Virulence TAI Protein 1e-26 71
ureB NP_287087.1 urease subunit beta Not tested TAI Protein 1e-26 71
ureB YP_005682175.1 Urease beta subunit Not tested PiCp 7 Protein 6e-25 61
ureB YP_005684267.1 Urease beta subunit Not tested PiCp 7 Protein 6e-25 61
ureB YP_005686359.1 Urease beta subunit Not tested PiCp 7 Protein 6e-25 61
ureB YP_003784326.1 urease subunit beta Not tested PiCp 7 Protein 9e-25 61